Hex:5 HexNAc:3 dHex:1

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Desmodus rotundus (Common vampire bat)
• Mus musculus (House mouse)
• Rattus norvegicus (Norway rat)
• Sus scrofa (Pig)
• Drosophila melanogaster (Fruit fly)
• Friend murine leukemia virus (F-mulv)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• A disintegrin and metalloproteinase with thrombospondin motifs 12 / Homo sapiens    P58397
• Acid ceramidase / Homo sapiens    Q13510
• Alpha-2-macroglobulin / Homo sapiens    P01023
• Angiotensin-converting enzyme 2 / Homo sapiens    Q9BYF1
• Apolipoprotein D / Homo sapiens    P05090
• Biglycan / Homo sapiens    P21810
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens    P06731
• Collagen alpha-1(VI) chain / Homo sapiens    P12109
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Collagen alpha-2(VI) chain / Homo sapiens    P12110
• Decorin / Homo sapiens    P07585
• Dystroglycan / Homo sapiens    Q14118
• Fibronectin / Homo sapiens    P02751
• Haptoglobin / Homo sapiens    P00738
• Heterogeneous nuclear ribonucleoprotein A/B isoform 2 / Homo sapiens    Q99729-2
• Immunoglobulin epsilon chain c region / Homo sapiens    P01854
• Immunoglobulin heavy constant delta / Homo sapiens    P01880
• Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens    P01854
• Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens    P01854
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Immunoglobulin J chain / Homo sapiens    P01591
• Integrin alpha-V / Homo sapiens    P06756
• Interleukin-1 receptor accessory protein / Homo sapiens    Q9NPH3
• Junctional adhesion molecule A / Homo sapiens    Q9Y624
• Lactotransferrin / Homo sapiens    P02788
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Mannan-binding lectin serine protease 1 / Homo sapiens    P48740
• Matrix-remodeling-associated protein 5 / Homo sapiens    Q9NR99
• Mucin-5B / Homo sapiens    Q9HC84
• Myelin protein P0 / Homo sapiens    P25189
• Myelin protein zero-like protein 1 / Homo sapiens    O95297
• Periostin / Homo sapiens    Q15063
• Phospholipase D3 / Homo sapiens    Q8IV08
• Podocalyxin / Homo sapiens    O00592
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Probable serine carboxypeptidase CPVL / Homo sapiens    Q9H3G5
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens    Q07954
• Rhodopsin / Homo sapiens    P08100
• Serpin h1 / Homo sapiens    P50454
• Tetraspanin-3 / Homo sapiens    O60637
• Thrombospondin-1 / Homo sapiens    P07996
• Thrombospondin-2 / Homo sapiens    P35442
• Thyroglobulin / Homo sapiens    P01266
• Transmembrane protein 106B / Homo sapiens    Q9NUM4
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• Acetylcholinesterase / Bos taurus    P23795
• Salivary plasminogen activator alpha 1 / Desmodus rotundus    P98119
• ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 / Mus musculus    P56528
• Angiotensin-converting enzyme / Mus musculus    P09470
• BDNF/NT-3 growth factors receptor / Mus musculus    P15209
• BTB/POZ domain-containing protein 17 / Mus musculus    Q9DB72
• Cadherin-10 / Mus musculus    P70408
• Cadherin-13 / Mus musculus    Q9WTR5
• Carboxypeptidase M / Mus musculus    Q80V42
• Cation-dependent mannose-6-phosphate receptor / Mus musculus    P24668
• CD166 antigen / Mus musculus    Q61490
• Cell adhesion molecule 4 / Mus musculus    Q8R464
• Ciliary neurotrophic factor receptor subunit alpha / Mus musculus    O88507
• Contactin-3 / Mus musculus    Q07409
• Contactin-associated protein-like 2 / Mus musculus    Q9CPW0
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus    Q9Z218
• Ephrin-A1 / Mus musculus    P52793
• Fibroblast growth factor receptor 1 / Mus musculus    P16092
• Hepatocyte cell adhesion molecule / Mus musculus    Q640R3
• IgLON family member 5 / Mus musculus    Q8HW98
• Immunoglobulin mu chain C region / Mus musculus    P01872
• Immunoglobulin superfamily member 8 / Mus musculus    Q8R366
• Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus    Q9R1V6-16
• Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus    O08532-4
• Leucine-rich glioma-inactivated protein 1 / Mus musculus    Q9JIA1
• Leukocyte surface antigen CD47 / Mus musculus    Q61735
• Low-density lipoprotein receptor-related protein 1B / Mus musculus    Q9JI18
• Lysosomal acid phosphatase / Mus musculus    P24638
• Lysosome-associated membrane glycoprotein 1 / Mus musculus    P11438
• Metabotropic glutamate receptor 3 / Mus musculus    Q9QYS2
• Myelin-oligodendrocyte glycoprotein / Mus musculus    Q61885
• Nectin-1 / Mus musculus    Q9JKF6
• Neural cell adhesion molecule L1 / Mus musculus    P11627
• Neurexin-3 / Mus musculus    Q6P9K9
• Neurexophilin-1 / Mus musculus    Q61200
• Neurexophilin-3 / Mus musculus    Q91VX5
• Neurofascin / Mus musculus    A0A087WPX3
• Neuronal cell adhesion molecule / Mus musculus    Q810U4
• Neuroplastin / Mus musculus    P97300
• Noelin / Mus musculus    O88998
• Oligodendrocyte-myelin glycoprotein / Mus musculus    Q63912
• Plexin-B1 / Mus musculus    Q8CJH3
• Plexin-B2 / Mus musculus    B2RXS4
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus    Q91ZX7
• Prostaglandin-H2 D-isomerase / Mus musculus    O09114
• Receptor-type tyrosine-protein phosphatase F / Mus musculus    A2A8L5
• Rho-associated protein kinase 2 / Mus musculus    P70336
• Roundabout homolog 2 / Mus musculus    Q7TPD3
• Signal-regulatory protein alpha / Mus musculus    P97797
• Sortilin-related receptor / Mus musculus    O88307
• Synaptophysin-like protein 1 / Mus musculus    O09117
• Tenascin-r / Mus musculus    Q8BYI9
• Tetraspanin-2 / Mus musculus    Q922J6
• Thrombospondin type-1 domain-containing protein 7A / Mus musculus    Q69ZU6
• Thy-1 membrane glycoprotein / Mus musculus    P01831
• Zinc transporter ZIP10 / Mus musculus    Q6P5F6
• Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus    P08289
• Major seminal plasma glycoprotein psp-i / Sus scrofa    P35495
• Major seminal plasma glycoprotein psp-ii / Sus scrofa    P35496
• Envelope glycoprotein / Friend murine leukemia virus    P03395
• Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Ascitic fluid (UBERON_0007795)  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Brain (UBERON_0000955)  
• Colon (UBERON_0001155)  
• Embryo (UBERON_0000922)  
• Liver (UBERON_0002107)   AH130 (CVCL_4367)  
• Liver (UBERON_0002107)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Retina (UBERON_0000966)  
• Seminal Fluid (UBERON_0006530)  
• BTI-Tn-5B1-4 (CVCL_C190)  
• Eveline (CVCL_A1LI)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• HEK293T (CVCL_0063)  
• LS174T (CVCL_1384)  
• Adipocytes (CL_0000136)  
• Adipose-derived stem cells (ADSCs) (CL_0000136)  
• Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)  

Reported structure

• Free / Lactose / [Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
• Free / Lactose / [Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
• Free / Lactose / [Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
• Free / Lactose / [Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
• Free / Lactose / [Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
• Free / Lactose / [Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
• Free / Lactose / [Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
• Free / Lactose / Structure 9212
• Free / Lactose / Structure 10113
• Free / Lactose / Structure 10115
• Free / Lactose / Structure 10848
• Free / Lactose / Structure 10849
• Free / Lactose / Structure 10850
• N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Hybrid / Man(?1-?)[Man(?1-?)]Man(a1-?)[GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
• N-Linked / Hybrid / Man(a1-3)[Man(a1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Hybrid / Structure 9493
• N-Linked / Hybrid / Structure 9585
• N-Linked / Hybrid / Structure 9591
• N-Linked / Hybrid / Structure 9730
• N-Linked / Hybrid / Structure 10267
• N-Linked / Hybrid / Structure 10426

Composition

• Hex:5 HexNAc:3 dHex:1 (avg mass : 1584.4553 )

Disease

• Cancer, breast (DOID:1612)
• Carcinoma, Hepatocellular (DOID:684)
• Colon adenocarcinoma (DOID:234)
• Control/Healthy
• COVID-19 (DOID:0080600)
• Myeloma, Multiple (DOID:9538)

Reference

• Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
• Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
• Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
• Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
• Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
• Increasing the Coverage of a Mass Spectral Library of Milk Oligosaccharides Using a Hybrid-Search-Based Bootstrapping Method and Milks from a Wide Variety of Mammals (2020 - Concepcion Africano Remoroza, Yuxue Liang, Tytus D. Mak, Yuri Mirokhin, Sergey L. Sheetlin, Xiaoyu Yang, Joice V. San Andres, Michael L. Power, and Stephen E. Stein) / Status : Unreviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Unreviewed
• Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Unreviewed
• Synthesis of Asymmetrical Multiantennary Human Milk Oligosaccharides (2017 - Anthony R Prudden, Lin Liu, Chantelle J Capicciotti, Margreet A Wolfert, Shuo Wang, Zhongwei Gao, Lu Meng, Kelley W Moremen, Geert-Jan Boons) / Status : Unreviewed
• A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Annotation and Structural Analysis of Sialylated Human Milk Oligosaccharides (2011 - Shuai Wu, Rudolf Grimm, J Bruce German, Carlito B Lebrilla) / Status : Unreviewed
• Development of an Annotated Library of Neutral Human Milk Oligosaccharides (2010 - Shuai Wu, Nannan Tao, J Bruce German, Rudolf Grimm, Carlito B Lebrilla) / Status : Unreviewed
• Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
• Hierarchy of post-translational modifications involved in the circulatory longevity of glycoproteins. Demonstration of concerted contributions of glycan sialylation and subunit assembly to the pharmacokinetic behavior of bovine acetylcholinesterase. (2000 - Kronman C, Chitlaru T, Elhanany E, Velan B, Shafferman A) / Status : Reviewed
• Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
• Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
• Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
• Structural studies of the N-linked sugar chains of human rhodopsin. (1994 - Fujita S, Endo T, Ju J, Kean E, Kobata A) / Status : Reviewed
• Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed
• Fractionation of sialyl oligosaccharides of human milk by ion-exchange chromatography (1978 - David F. Smith, David A. Zorf, Victor Ginsburg) / Status : Reviewed
• Oligosaccharides of human milk: Structural studies of Di- and trifucosyl derivatives of lacto-N-octaose and lacto-N-neooctaose (1978 - Yoko Tachibana, Katsuko Yamashita, Akira Kobata) / Status : Reviewed

Reported glycosite

• A disintegrin and metalloproteinase with thrombospondin motifs 12 / Homo sapiens
  •        Asn-1276
• Acid ceramidase / Homo sapiens
  •        Asn-259
  •        Asn-286
• Alpha-2-macroglobulin / Homo sapiens
  •        Asn-410
• Angiotensin-converting enzyme 2 / Homo sapiens
  •        Undefined site
• Apolipoprotein D / Homo sapiens
  •        Asn-98
• Biglycan / Homo sapiens
  •        Asn-270
  •        Asn-311
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
  •        Undefined site
• Collagen alpha-1(VI) chain / Homo sapiens
  •        Asn-804
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-2528
  •        Asn-2679
• Collagen alpha-2(VI) chain / Homo sapiens
  •        Asn-140
• Decorin / Homo sapiens
  •        Asn-211
• Dystroglycan / Homo sapiens
  •        Asn-661
• Fibronectin / Homo sapiens
  •        Asn-528
  •        Asn-542
• Haptoglobin / Homo sapiens
  •        Asn-207
  •        Asn-211
• Heterogeneous nuclear ribonucleoprotein A/B isoform 2 / Homo sapiens
  •        Asn-61
• Immunoglobulin epsilon chain c region / Homo sapiens
  •        Asn-264
• Immunoglobulin heavy constant delta / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Asn-46
  •        Asn-272
• Immunoglobulin J chain / Homo sapiens
  •        Asn-71
• Integrin alpha-V / Homo sapiens
  •        Asn-74
• Interleukin-1 receptor accessory protein / Homo sapiens
  •        Asn-118
• Junctional adhesion molecule A / Homo sapiens
  •        Asn-185
• Lactotransferrin / Homo sapiens
  •        Asn-497
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-249
  •        Asn-261
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-58
  •        Asn-123
  •        Asn-356
• Mannan-binding lectin serine protease 1 / Homo sapiens
  •        Asn-178
• Matrix-remodeling-associated protein 5 / Homo sapiens
  •        Asn-2007
  •        Asn-2500
  •        Asn-2693
• Mucin-5B / Homo sapiens
  •        Asn-5046
• Myelin protein P0 / Homo sapiens
  •        Asn-122
• Myelin protein zero-like protein 1 / Homo sapiens
  •        Asn-50
• Periostin / Homo sapiens
  •        Asn-599
• Phospholipase D3 / Homo sapiens
  •        Asn-236
• Podocalyxin / Homo sapiens
  •        Asn-360
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-83
  •        Asn-90
  •        Asn-186
  •        Asn-499
• Probable serine carboxypeptidase CPVL / Homo sapiens
  •        Asn-307
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
  •        Asn-3839
• Rhodopsin / Homo sapiens
  •        Undefined site
• Serpin h1 / Homo sapiens
  •        Asn-125
• Tetraspanin-3 / Homo sapiens
  •        Asn-167
• Thrombospondin-1 / Homo sapiens
  •        Asn-360
  •        Asn-1067
• Thrombospondin-2 / Homo sapiens
  •        Asn-330
• Thyroglobulin / Homo sapiens
  •        Asn-1365
• Transmembrane protein 106B / Homo sapiens
  •        Asn-256
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-128
• Acetylcholinesterase / Bos taurus
  •        Undefined site
• Salivary plasminogen activator alpha 1 / Desmodus rotundus
  •        Asn-153
• ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 / Mus musculus
  •        Asn-223
• Angiotensin-converting enzyme / Mus musculus
  •        Asn-514
• BDNF/NT-3 growth factors receptor / Mus musculus
  •        Asn-241
• BTB/POZ domain-containing protein 17 / Mus musculus
  •        Asn-307
• Cadherin-10 / Mus musculus
  •        Asn-438
• Cadherin-13 / Mus musculus
  •        Asn-598
  •        Asn-638
• Carboxypeptidase M / Mus musculus
  •        Asn-38
• Cation-dependent mannose-6-phosphate receptor / Mus musculus
  •        Asn-58
• CD166 antigen / Mus musculus
  •        Asn-480
• Cell adhesion molecule 4 / Mus musculus
  •        Asn-67
• Ciliary neurotrophic factor receptor subunit alpha / Mus musculus
  •        Asn-142
• Contactin-3 / Mus musculus
  •        Asn-65
• Contactin-associated protein-like 2 / Mus musculus
  •        Asn-735
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
  •        Asn-113
• Ephrin-A1 / Mus musculus
  •        Asn-26
• Fibroblast growth factor receptor 1 / Mus musculus
  •        Asn-264
• Hepatocyte cell adhesion molecule / Mus musculus
  •        Asn-189
• IgLON family member 5 / Mus musculus
  •        Asn-288
• Immunoglobulin mu chain C region / Mus musculus
  •        Asn-280
• Immunoglobulin superfamily member 8 / Mus musculus
  •        Asn-137
  •        Asn-325
• Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
  •        Asn-632
• Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
  •        Asn-324
• Leucine-rich glioma-inactivated protein 1 / Mus musculus
  •        Asn-422
• Leukocyte surface antigen CD47 / Mus musculus
  •        Asn-61
  •        Asn-109
• Low-density lipoprotein receptor-related protein 1B / Mus musculus
  •        Asn-725
  •        Asn-1549
• Lysosomal acid phosphatase / Mus musculus
  •        Asn-92
• Lysosome-associated membrane glycoprotein 1 / Mus musculus
  •        Asn-159
• Metabotropic glutamate receptor 3 / Mus musculus
  •        Asn-439
• Myelin-oligodendrocyte glycoprotein / Mus musculus
  •        Asn-59
• Nectin-1 / Mus musculus
  •        Asn-202
• Neural cell adhesion molecule L1 / Mus musculus
  •        Asn-246
  •        Asn-478
  •        Asn-978
  •        Asn-1107
• Neurexin-3 / Mus musculus
  •        Asn-1287
• Neurexophilin-1 / Mus musculus
  •        Asn-146
• Neurexophilin-3 / Mus musculus
  •        Asn-127
• Neurofascin / Mus musculus
  •        Asn-866
  •        Asn-881
  •        Asn-1047
• Neuronal cell adhesion molecule / Mus musculus
  •        Asn-217
  •        Asn-308
• Neuroplastin / Mus musculus
  •        Asn-196
• Noelin / Mus musculus
  •        Asn-473
• Oligodendrocyte-myelin glycoprotein / Mus musculus
  •        Asn-234
• Plexin-B1 / Mus musculus
  •        Asn-31
• Plexin-B2 / Mus musculus
  •        Asn-735
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
  •        Asn-1512
  •        Asn-1576
  •        Asn-3789
  •        Asn-3840
  •        Asn-3954
  •        Asn-4126
• Prostaglandin-H2 D-isomerase / Mus musculus
  •        Asn-51
• Receptor-type tyrosine-protein phosphatase F / Mus musculus
  •        Asn-721
• Rho-associated protein kinase 2 / Mus musculus
  •        Asn-791
• Roundabout homolog 2 / Mus musculus
  •        Asn-793
• Signal-regulatory protein alpha / Mus musculus
  •        Asn-92
  •        Asn-110
• Sortilin-related receptor / Mus musculus
  •        Asn-158
• Synaptophysin-like protein 1 / Mus musculus
  •        Asn-72
• Tenascin-r / Mus musculus
  •        Asn-581
  •        Asn-1261
• Tetraspanin-2 / Mus musculus
  •        Asn-139
• Thrombospondin type-1 domain-containing protein 7A / Mus musculus
  •        Asn-439
• Thy-1 membrane glycoprotein / Mus musculus
  •        Asn-94
  •        Asn-118
• Zinc transporter ZIP10 / Mus musculus
  •        Asn-341
• Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
  •        Undefined site
• Major seminal plasma glycoprotein psp-i / Sus scrofa
  •        Asn-71
• Major seminal plasma glycoprotein psp-ii / Sus scrofa
  •        Asn-119
• Envelope glycoprotein / Friend murine leukemia virus
  •        Asn-12
• Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-1074
  •        Asn-1098
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-17
  •        Asn-61
  •        Asn-122
  •        Asn-149
  •        Asn-165
  •        Asn-234
  •        Asn-331
  •        Asn-343
  •        Asn-602
  •        Asn-615
  •        Asn-717
  •        Asn-801
  •        Asn-1074
  •        Asn-1098
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-343
  •        Asn-717
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-343

Mass spectrometry observed peptide

• QCVNLTTR (8aa)
  •    P0DTC2    Asn-17     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• HIVFWNSSNPK (11aa)
  •    P52793    Asn-26     Ephrin-A1 / Mus musculus
• SPLPAAFTANGTHLQHLAR (19aa)
  •    Q8CJH3    Asn-31     Plexin-B1 / Mus musculus
• SVAQNYSSITHLHSIGK (17aa)
  •    Q80V42    Asn-38     Carboxypeptidase M / Mus musculus
• EIFVANGTQGK (11aa)
  •    O95297    Asn-50     Myelin protein zero-like protein 1 / Homo sapiens
• WYSAGLASNSSWFR (14aa)
  •    O09114    Asn-51     Prostaglandin-H2 D-isomerase / Mus musculus
• YETTNK (6aa)
  •    P13473    Asn-58     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• LRPLFNK (7aa)
  •    P24668    Asn-58     Cation-dependent mannose-6-phosphate receptor / Mus musculus
• ISPGKNATGMEVGWYR (16aa)
  •    Q61885    Asn-59     Myelin-oligodendrocyte glycoprotein / Mus musculus
• NATGMEVGWYR (11aa)
  •    Q61885    Asn-59     Myelin-oligodendrocyte glycoprotein / Mus musculus
• FSNVTWF (7aa)
  •    P0DTC2    Asn-61     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• GESPAGAGTGAAAGAGGATAAPPSGNQNGAEGDQINASK (39aa)
  •    Q99729-2    Asn-61     Heterogeneous nuclear ribonucleoprotein A/B isoform 2 / Homo sapiens
• WKLNK (5aa)
  •    Q61735    Asn-61     Leukocyte surface antigen CD47 / Mus musculus
• WQLNGSDIDTSLDHR (15aa)
  •    Q07409    Asn-65     Contactin-3 / Mus musculus
• QTLFFNGTR (9aa)
  •    Q8R464    Asn-67     Cell adhesion molecule 4 / Mus musculus
• RIIVPLNNRENISDPTSPLRT (21aa)
  •    P01591    Asn-71     Immunoglobulin J chain / Homo sapiens
• RENISDPTSPLRT (13aa)
  •    P01591    Asn-71     Immunoglobulin J chain / Homo sapiens
• VGVNKNQTVTATFGYPFR (18aa)
  •    O09117    Asn-72     Synaptophysin-like protein 1 / Mus musculus
• ANTTQPGIVEGGQVIK (16aa)
  •    P06756    Asn-74     Integrin alpha-V / Homo sapiens
• RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
  •    P01833    Asn-83     Polymeric immunoglobulin receptor / Homo sapiens
  •    P01833    Asn-90     Polymeric immunoglobulin receptor / Homo sapiens
• IRNVSDTTKR (10aa)
  •    P97797    Asn-92     Signal-regulatory protein alpha / Mus musculus
• IRNVSDTTK (9aa)
  •    P97797    Asn-92     Signal-regulatory protein alpha / Mus musculus
• YHGFLNTSYHR (11aa)
  •    P24638    Asn-92     Lysosomal acid phosphatase / Mus musculus
• VLTLANFTTK (10aa)
  •    P01831    Asn-94     Thy-1 membrane glycoprotein / Mus musculus
• ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
  •    P05090    Asn-98     Apolipoprotein D / Homo sapiens
• ADGTVNQIEGEATPVNLTEPAK (22aa)
  •    P05090    Asn-98     Apolipoprotein D / Homo sapiens
• DAMVGNYTCEVTELSR (16aa)
  •    Q61735    Asn-109     Leukocyte surface antigen CD47 / Mus musculus
• ISNVTPADAGIYYCVK (16aa)
  •    P97797    Asn-110     Signal-regulatory protein alpha / Mus musculus
• NVETNNSTVLIEGK (14aa)
  •    Q9Z218    Asn-113     Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
• NTTYCSK (7aa)
  •    Q9NPH3    Asn-118     Interleukin-1 receptor accessory protein / Homo sapiens
• DEGDYFCELQVSGANPMSSNK (21aa)
  •    P01831    Asn-118     Thy-1 membrane glycoprotein / Mus musculus
• DGSIVIHNLDYSDNGTFTCDVK (22aa)
  •    P25189    Asn-122     Myelin protein P0 / Homo sapiens
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• AASTYSIDSVSFSYNTGDNTTFPDAEDK (28aa)
  •    P13473    Asn-123     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• IVDHGNGTFSVHFR (14aa)
  •    Q91VX5    Asn-127     Neurexophilin-3 / Mus musculus
• FGCEIENNR (9aa)
  •    P25311    Asn-128     Zinc-alpha-2-glycoprotein / Homo sapiens
• LQAQDSGFYECYTPSTDTQYLGNYSAK (27aa)
  •    Q8R366    Asn-137     Immunoglobulin superfamily member 8 / Mus musculus
• ARGNGTLITFHSAFQCCGK (19aa)
  •    Q922J6    Asn-139     Tetraspanin-2 / Mus musculus
• GTFTDCALANMTEQIR (16aa)
  •    P12110    Asn-140     Collagen alpha-2(VI) chain / Homo sapiens
• GFYCSWHLPTPTYIPNTFNVTVLHGSK (27aa)
  •    O88507    Asn-142     Ciliary neurotrophic factor receptor subunit alpha / Mus musculus
• IVDHGNGTFSVYFR (14aa)
  •    Q61200    Asn-146     Neurexophilin-1 / Mus musculus
• YHKNNKSWMESEF (13aa)
  •    P0DTC2    Asn-149     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• LNFGVGNNSEAVISQFYHSPADNKR (25aa)
  •    O88307    Asn-158     Sortilin-related receptor / Mus musculus
• VYMKNVTVVLR (11aa)
  •    P11438    Asn-159     Lysosome-associated membrane glycoprotein 1 / Mus musculus
• SSANNCTFEYVSQPF (15aa)
  •    P0DTC2    Asn-165     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NQSVPISCCR (10aa)
  •    O60637    Asn-167     Tetraspanin-3 / Homo sapiens
• FGYILHTDNR (10aa)
  •    P48740    Asn-178     Mannan-binding lectin serine protease 1 / Homo sapiens
• AFSNSSYVINPTTGEIVFDPISASDTGEYSCEAR (34aa)
  •    Q9Y624    Asn-185     Junctional adhesion molecule A / Homo sapiens
• QIGLYPVLVIDSSGYVNPNYTGR (23aa)
  •    P01833    Asn-186     Polymeric immunoglobulin receptor / Homo sapiens
• DGKPLLNDSR (10aa)
  •    Q640R3    Asn-189     Hepatocyte cell adhesion molecule / Mus musculus
• NASNMEYR (8aa)
  •    P97300    Asn-196     Neuroplastin / Mus musculus
• KNASNMEYR (9aa)
  •    P97300    Asn-196     Neuroplastin / Mus musculus
• NGVELTATRKNASNMEYR (18aa)
  •    P97300    Asn-196     Neuroplastin / Mus musculus
• LKGEAEYQEIRNPNGTVTVISR (22aa)
  •    Q9JKF6    Asn-202     Nectin-1 / Mus musculus
• IADTNITSIPQGIPPSITEIHIDGNK (26aa)
  •    P07585    Asn-211     Decorin / Homo sapiens
• NLFLNHSENAT (11aa)
  •    P00738    Asn-207     Haptoglobin / Homo sapiens
  •    P00738    Asn-211     Haptoglobin / Homo sapiens
• KNLFLNHSENATAKD (15aa)
  •    P00738    Asn-211     Haptoglobin / Homo sapiens
• FNHTQTIQQK (10aa)
  •    Q810U4    Asn-217     Neuronal cell adhesion molecule / Mus musculus
• EPFYKNSTFGSVEVFSLDPNKVHK (24aa)
  •    P56528    Asn-223     ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 / Mus musculus
• WSCDHKQNITYLLK (14aa)
  •    Q63912    Asn-234     Oligodendrocyte-myelin glycoprotein / Mus musculus
• GINIT (5aa)
  •    P0DTC2    Asn-234     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EIGVVMYNCSCIAR (14aa)
  •    Q8IV08    Asn-236     Phospholipase D3 / Homo sapiens
• HMNETSHTQGSLR (13aa)
  •    P15209    Asn-241     BDNF/NT-3 growth factors receptor / Mus musculus
• LLFPTNSSSR (10aa)
  •    P11627    Asn-246     Neural cell adhesion molecule L1 / Mus musculus
• KDNTTVTR (8aa)
  •    P11279    Asn-249     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• YQYVDCGRNTT (11aa)
  •    Q9NUM4    Asn-256     Transmembrane protein 106B / Homo sapiens
• TVIENSTSYEEAK (13aa)
  •    Q13510    Asn-259     Acid ceramidase / Homo sapiens
• IININPNK (8aa)
  •    P11279    Asn-261     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• SPHRPILQAGLPANK (15aa)
  •    P16092    Asn-264     Fibroblast growth factor receptor 1 / Mus musculus
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270     Biglycan / Homo sapiens
• THTNISESHPNATFSAVGEASICEDDWNSGER (32aa)
  •    P01871    Asn-272     Immunoglobulin heavy constant mu / Homo sapiens
• IMESHPNGTFSAK (13aa)
  •    P01872    Asn-280     Immunoglobulin mu chain C region / Mus musculus
• IIAPAYFIIGGNQSGEGCVITR (22aa)
  •    Q13510    Asn-286     Acid ceramidase / Homo sapiens
• HYGNYTCR (8aa)
  •    Q8HW98    Asn-288     IgLON family member 5 / Mus musculus
• IIDGDITSDPSYFQNVTGCSNYYNFIR (27aa)
  •    Q9H3G5    Asn-307     Probable serine carboxypeptidase CPVL / Homo sapiens
• FFHVNGSAFLPR (12aa)
  •    Q9DB72    Asn-307     BTB/POZ domain-containing protein 17 / Mus musculus
• EDGMLPANR (9aa)
  •    Q810U4    Asn-308     Neuronal cell adhesion molecule / Mus musculus
• IIQVVYIHSNNITK (14aa)
  •    P21810    Asn-311     Biglycan / Homo sapiens
• VLKDAVNNITAK (12aa)
  •    O08532-4    Asn-324     Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
• RIGPGEPLELLCNVSGALPPPGR (23aa)
  •    Q8R366    Asn-325     Immunoglobulin superfamily member 8 / Mus musculus
• IGPGEPLELLCNVSGALPPPGR (22aa)
  •    Q8R366    Asn-325     Immunoglobulin superfamily member 8 / Mus musculus
• FFAENETWVVDSCTTCTCK (19aa)
  •    P35442    Asn-330     Thrombospondin-2 / Homo sapiens
• RFPNIT (6aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• DQSEDDRQHECLNVTQLLK (19aa)
  •    Q6P5F6    Asn-341     Zinc transporter ZIP10 / Mus musculus
• GEVFNATRF (9aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VFNATR (6aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• GEVFNATR (8aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VQPFNVTQGK (10aa)
  •    P13473    Asn-356     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• KVSCPIMPCSNATVPDGECCPR (22aa)
  •    P07996    Asn-360     Thrombospondin-1 / Homo sapiens
• QIVINITGNTICAGGASDEK (20aa)
  •    O00592    Asn-360     Podocalyxin / Homo sapiens
• SINTTNVMGTSLTVR (15aa)
  •    P01023    Asn-410     Alpha-2-macroglobulin / Homo sapiens
• ATQLFTNQTDIPNMEDVYAVK (21aa)
  •    Q9JIA1    Asn-422     Leucine-rich glioma-inactivated protein 1 / Mus musculus
• IFNIHSGNGSLYTSKPLDR (19aa)
  •    P70408    Asn-438     Cadherin-10 / Mus musculus
• RANQTALCGGGVQTR (15aa)
  •    Q69ZU6    Asn-439     Thrombospondin type-1 domain-containing protein 7A / Mus musculus
• ANQTALCGGGVQTR (14aa)
  •    Q69ZU6    Asn-439     Thrombospondin type-1 domain-containing protein 7A / Mus musculus
• INFTAPFNPNK (11aa)
  •    Q9QYS2    Asn-439     Metabotropic glutamate receptor 3 / Mus musculus
• ALYAWNNGHQTLYNVTLFHVIR (22aa)
  •    O88998    Asn-473     Noelin / Mus musculus
• FFPYANGTLSIR (12aa)
  •    P11627    Asn-478     Neural cell adhesion molecule L1 / Mus musculus
• IIISPEENVTLTCTAENQLER (21aa)
  •    Q61490    Asn-480     CD166 antigen / Mus musculus
• RTAGWNIPMGLLFNQTGSCKF (21aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• KYWCKWNNTGCQALPSQDEGPSKA (24aa)
  •    P01833    Asn-499     Polymeric immunoglobulin receptor / Homo sapiens
• KWNNTGCQALPSQDEGPSKA (20aa)
  •    P01833    Asn-499     Polymeric immunoglobulin receptor / Homo sapiens
• YQGICPPVARNETHFDAGAK (20aa)
  •    P09470    Asn-514     Angiotensin-converting enzyme / Mus musculus
• DQCIVDDITYNVNDTFHK (18aa)
  •    P02751    Asn-528     Fibronectin / Homo sapiens
• RHEEGHMINCTCFGQGR (17aa)
  •    P02751    Asn-542     Fibronectin / Homo sapiens
• GTNESEASSTQFTTEIDAPK (20aa)
  •    Q8BYI9    Asn-581     Tenascin-r / Mus musculus
• NLSVVILGASDKDLHPNTDPFKFEIHK (27aa)
  •    Q9WTR5    Asn-598     Cadherin-13 / Mus musculus
• EVNDTLLVNELK (12aa)
  •    Q15063    Asn-599     Periostin / Homo sapiens
• GGVSVITPGTNTSNQVAVLY (20aa)
  •    P0DTC2    Asn-602     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VITPGTNTS (9aa)
  •    P0DTC2    Asn-602     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• LYQDVNCT (8aa)
  •    P0DTC2    Asn-615     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• TLNCSGAHVK (10aa)
  •    Q9R1V6-16    Asn-632     Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
• ISKINNTHALVSLLQNLNK (19aa)
  •    Q9WTR5    Asn-638     Cadherin-13 / Mus musculus
• SIVVEWTNNTLPLEPCPK (18aa)
  •    Q14118    Asn-661     Dystroglycan / Homo sapiens
• NSIAIPTNFTISVTTEILPVSMTK (24aa)
  •    P0DTC2    Asn-717     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NFTIS (5aa)
  •    P0DTC2    Asn-717     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• KVEVEPLNSTAVHVSWK (17aa)
  •    A2A8L5    Asn-721     Receptor-type tyrosine-protein phosphatase F / Mus musculus
• VFLNGTHR (8aa)
  •    Q9JI18    Asn-725     Low-density lipoprotein receptor-related protein 1B / Mus musculus
• LSHDGNETLPLHLYVK (16aa)
  •    B2RXS4    Asn-735     Plexin-B2 / Mus musculus
• CACGIERNCTDPK (13aa)
  •    Q9CPW0    Asn-735     Contactin-associated protein-like 2 / Mus musculus
• NLTLK (5aa)
  •    P70336    Asn-791     Rho-associated protein kinase 2 / Mus musculus
• FHINK (5aa)
  •    Q7TPD3    Asn-793     Roundabout homolog 2 / Mus musculus
• DFGGFNFSQILPDPSKPSK (19aa)
  •    P0DTC2    Asn-801     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NVTAQICIDK (10aa)
  •    P12109    Asn-804     Collagen alpha-1(VI) chain / Homo sapiens
• YVPFNGTK (8aa)
  •    A0A087WPX3    Asn-866     Neurofascin / Mus musculus
• QMVENFSPNQTK (12aa)
  •    A0A087WPX3    Asn-881     Neurofascin / Mus musculus
• THNLTNLNPDLQYR (14aa)
  •    P11627    Asn-978     Neural cell adhesion molecule L1 / Mus musculus
• HNFRPGTDFVVEYIDSNHTKK (21aa)
  •    A0A087WPX3    Asn-1047     Neurofascin / Mus musculus
• HNFRPGTDFVVEYIDSNHTK (20aa)
  •    A0A087WPX3    Asn-1047     Neurofascin / Mus musculus
• VVNSTTGPGEHIR (13aa)
  •    P07996    Asn-1067     Thrombospondin-1 / Homo sapiens
• VPAQEKNF (8aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VPAQEKNFTTAPAICHDGK (19aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NFTTAPAICHDGK (13aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• HVTYVPAQEKNF (12aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EGVFVSNGTHW (11aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFV (7aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• TNGTGPVR (8aa)
  •    P11627    Asn-1107     Neural cell adhesion molecule L1 / Mus musculus
• VLLHHLDVKTNGTGPVR (17aa)
  •    P11627    Asn-1107     Neural cell adhesion molecule L1 / Mus musculus
• IGSYNGTAGDSLSYHQGRPFSTEDRDNDVAVTNCAMSYK (39aa)
  •    Q8BYI9    Asn-1261     Tenascin-r / Mus musculus
• LPNNMNQTK (9aa)
  •    P58397    Asn-1276     A disintegrin and metalloproteinase with thrombospondin motifs 12 / Homo sapiens
• VLNMAAENNPNIKINGSVR (19aa)
  •    Q6P9K9    Asn-1287     Neurexin-3 / Mus musculus
• WTGHNVTVVQR (11aa)
  •    Q91ZX7    Asn-1512     Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
• GPCSHLCLINHNR (13aa)
  •    Q9JI18    Asn-1549     Low-density lipoprotein receptor-related protein 1B / Mus musculus
• LHKDNTTCYEFKK (13aa)
  •    Q91ZX7    Asn-1576     Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
• ITLHENR (7aa)
  •    Q9NR99    Asn-2007     Matrix-remodeling-associated protein 5 / Homo sapiens
• ITVHGNGSLDIR (12aa)
  •    Q9NR99    Asn-2500     Matrix-remodeling-associated protein 5 / Homo sapiens
• MIEAYNITEK (10aa)
  •    Q99715    Asn-2528     Collagen alpha-1(XII) chain / Homo sapiens
• EAGNITTDGYEIIGK (15aa)
  •    Q99715    Asn-2679     Collagen alpha-1(XII) chain / Homo sapiens
• VSIIDNGTITVR (12aa)
  •    Q9NR99    Asn-2693     Matrix-remodeling-associated protein 5 / Homo sapiens
• LTSCATNASMCGDEAR (16aa)
  •    Q91ZX7    Asn-3789     Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
• FGTCSQICNNTK (12aa)
  •    Q07954    Asn-3839     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
• FGTCSQLCNNTK (12aa)
  •    Q91ZX7    Asn-3840     Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
• GVTHLNISGLK (11aa)
  •    Q91ZX7    Asn-3954     Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
• FGHSPLINLTGGLSHASDVVLYHQHK (26aa)
  •    Q91ZX7    Asn-4126     Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
• VVLLDPKPVANVTCVNK (17aa)
  •    Q9HC84    Asn-5046     Mucin-5B / Homo sapiens