Hex:7 HexNAc:6 NeuAc:3

Taxonomy

• Homo sapiens (Human)
• Mus musculus (House mouse)
• Ovis aries (Sheep)
• Torpedo californica (Pacific electric ray)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Adenosine deaminase 2 / Homo sapiens    Q9NZK5
• Adhesion G protein-coupled receptor L4 / Homo sapiens    Q9HBW9
• Alpha-1-acid glycoprotein 1 / Homo sapiens    P02763
• Alpha-1-acid glycoprotein 2 / Homo sapiens    P19652
• Alpha-1-antichymotrypsin / Homo sapiens    P01011
• Alpha-1-antitrypsin / Homo sapiens    P01009
• Apolipoprotein (a) / Homo sapiens    P08519
• Attractin / Homo sapiens    O75882
• Carboxypeptidase b2 / Homo sapiens    Q96IY4
• Carboxypeptidase N subunit 2 / Homo sapiens    P22792
• CD59 glycoprotein / Homo sapiens    P13987
• Ceruloplasmin / Homo sapiens    P00450
• Coagulation factor IX / Homo sapiens    P00740
• Dipeptidyl peptidase 4 / Homo sapiens    P27487
• Epidermal growth factor receptor / Homo sapiens    P00533
• Erythropoietin / Homo sapiens    P01588
• Fibrillin-1 / Homo sapiens    P35555
• Frizzled-6 / Homo sapiens    O60353
• Galectin-3-binding protein / Homo sapiens    Q08380
• Haptoglobin / Homo sapiens    P00738
• Hepatocyte growth factor receptor / Homo sapiens    P08581
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Kininogen-1 / Homo sapiens    P01042
• Laminin subunit alpha-2 / Homo sapiens    P24043
• Leucine-rich alpha-2-glycoprotein / Homo sapiens    P02750
• Maltase-glucoamylase, intestinal / Homo sapiens    O43451
• Mesothelin / Homo sapiens    Q13421
• Multimerin-1 / Homo sapiens    Q13201
• Multimerin-2 / Homo sapiens    Q9H8L6
• Multiple epidermal growth factor-like domains protein 8 / Homo sapiens    Q7Z7M0
• Oncostatin-M-specific receptor subunit beta / Homo sapiens    Q99650
• Pantetheinase / Homo sapiens    O95497
• Plasma serine protease inhibitor / Homo sapiens    P05154
• Plasminogen / Homo sapiens    P00747
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Prothrombin / Homo sapiens    P00734
• Receptor-type tyrosine-protein phosphatase F / Homo sapiens    P10586
• Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens    Q15262
• Semaphorin-4B / Homo sapiens    Q9NPR2
• Serum paraoxonase/arylesterase 1 / Homo sapiens    P27169
• Target of Nesh-SH3 / Homo sapiens    Q7Z7G0
• Trem-like transcript 2 protein / Homo sapiens    Q5T2D2
• Tyrosine-protein kinase receptor UFO / Homo sapiens    P30530
• Uromodulin / Homo sapiens    P07911
• WAP four-disulfide core domain protein 2 / Homo sapiens    Q14508
• Signal-regulatory protein alpha / Mus musculus    P97797
• Alpha-1-acid glycoprotein / Ovis aries    W5P7S6
• Acetylcholine receptor protein / Torpedo californica    P02710    P02714    P02712    P02718
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Brain (UBERON_0000955)  
• Electric Organ (UBERON_0006869)  
• Milk (UBERON_0001913)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Urine (UBERON_0001088)  
• HEK293 (CVCL_0045)  

Reported structure

• N-Linked / Complex / Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)GlcNAc(?1-?) + 3 x NeuAc(a2-?)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x NeuAc"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x NeuAc(a2-?)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ NeuAc(a2-3) + 2 x NeuAc(a2-6)"
• N-Linked / Complex / Structure 2404
• N-Linked / Complex / Structure 9272
• N-Linked / Complex / Structure 10803

Composition

• Hex:7 HexNAc:6 NeuAc:3 (avg mass : 3245.9558 )

Disease

• Control/Healthy
• COVID-19 (DOID:0080600)
• Familial hepatic adenoma (DOID:111366)
• Maturity-onset diabetes of the young type 3 (DOID:0111102)
• Prostate cancer (DOID:10283)

Reference

• Aberrant sialylation in a patient with a HNF1α variant and liver adenomatosis (2021 - Luisa Sturiale, Marie-Cécile Nassogne, Angelo Palmigiano, Angela Messina, Immacolata Speciale, Rosangela Artuso, Gaetano Bertino, Nicole Revencu, Xavier Stephénne, Cristina De Castro, Gert Matthijs, Rita Barone, Jaak Jaeken, Domenico Garozzo) / Status : Reviewed
• Community Evaluation of Glycoproteomics Informatics Solutions Reveals High-Performance Search Strategies for Glycopeptide Analysis (2021 - Rebeca Kawahara, Kathirvel Alagesan, Marshall Bern, Meng Bo, Weiqian Cao, Robert J Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet-Weiland, Mingqi Liu, Yehia Mechref, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Vakhrushev, Christina Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Zhang Yong, Hui Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Goran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, and Morten Thaysen-Andersen) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
• Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
• Cysteine Aminoethylation Enables the Site-Specific Glycosylation Analysis of Recombinant Human Erythropoietin using Trypsin (2020 - Steffen Lippold, Alexander Büttner, Matthew S.F. Choo, Michaela Hook, Coen J. de Jong, Terry Nguyen-Khuong, Markus Haberger, Dietmar Reusch, Manfred Wuhrer, Noortje de Haan) / Status : Reviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Comparison of sialylated N-glycopeptide levels in serum of pancreatic cancer patients, acute pancreatitis patients, and healthy controls (2014 - Kontro H, Joenväärä S, Haglund C, Renkonen R) / Status : Reviewed
• Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
• Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
• Structural analysis of N-linked sugar chains of human blood clotting factor IX. (2000 - Makino Y, Omichi K, Kuraya N, Ogawa H, Nishimura H, Iwanaga S, Hase S) / Status : Reviewed
• Structural determination of N-linked carbohydrates by matrix-assisted laser desorption/ionization-mass spectrometry following enzymatic release within sodium dodecyl sulfate-polyacrylamide electrophoresis gels: application to species-specific glycosylation of alpha1-acid glycoprotein. (1998 - Kuster B, Hunter A, Wheeler S, Dwek R, Harvey D) / Status : Reviewed
• Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
• Oligosaccharide structures present on asparagine-289 of recombinant human plasminogen expressed in a Chinese hamster ovary cell line. (1991 - Davidson D, Castellino F) / Status : Reviewed

Reported glycosite

• Adenosine deaminase 2 / Homo sapiens
  •        Asn-174
  •        Asn-378
• Adhesion G protein-coupled receptor L4 / Homo sapiens
  •        Asn-249
• Alpha-1-acid glycoprotein 1 / Homo sapiens
  •        Undefined site
  •        Asn-33
  •        Asn-72
  •        Asn-93
• Alpha-1-acid glycoprotein 2 / Homo sapiens
  •        Undefined site
  •        Asn-33
  •        Asn-72
  •        Asn-88
  •        Asn-93
• Alpha-1-antichymotrypsin / Homo sapiens
  •        Asn-106
  •        Asn-271
• Alpha-1-antitrypsin / Homo sapiens
  •        Undefined site
  •        Asn-107
• Apolipoprotein (a) / Homo sapiens
  •        Asn-4057
• Attractin / Homo sapiens
  •        Asn-416
• Carboxypeptidase b2 / Homo sapiens
  •        Asn-73
• Carboxypeptidase N subunit 2 / Homo sapiens
  •        Asn-348
• CD59 glycoprotein / Homo sapiens
  •        Asn-43
• Ceruloplasmin / Homo sapiens
  •        Asn-138
  •        Asn-762
• Coagulation factor IX / Homo sapiens
  •        Undefined site
• Dipeptidyl peptidase 4 / Homo sapiens
  •        Asn-150
• Epidermal growth factor receptor / Homo sapiens
  •        Asn-271
• Erythropoietin / Homo sapiens
  •        Asn-65
• Fibrillin-1 / Homo sapiens
  •        Asn-2767
• Frizzled-6 / Homo sapiens
  •        Asn-38
• Galectin-3-binding protein / Homo sapiens
  •        Asn-398
• Haptoglobin / Homo sapiens
  •        Asn-207
  •        Asn-211
  •        Asn-241
• Hepatocyte growth factor receptor / Homo sapiens
  •        Asn-1171
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Asn-272
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-517
• Kininogen-1 / Homo sapiens
  •        Asn-169
• Laminin subunit alpha-2 / Homo sapiens
  •        Asn-2558
• Leucine-rich alpha-2-glycoprotein / Homo sapiens
  •        Asn-186
• Maltase-glucoamylase, intestinal / Homo sapiens
  •        Asn-912
• Mesothelin / Homo sapiens
  •        Asn-523
• Multimerin-1 / Homo sapiens
  •        Asn-576
• Multimerin-2 / Homo sapiens
  •        Asn-205
• Multiple epidermal growth factor-like domains protein 8 / Homo sapiens
  •        Asn-1271
• Oncostatin-M-specific receptor subunit beta / Homo sapiens
  •        Asn-176
• Pantetheinase / Homo sapiens
  •        Asn-130
• Plasma serine protease inhibitor / Homo sapiens
  •        Asn-262
• Plasminogen / Homo sapiens
  •        Undefined site
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-51
• Prothrombin / Homo sapiens
  •        Asn-121
• Receptor-type tyrosine-protein phosphatase F / Homo sapiens
  •        Asn-1731
• Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
  •        Asn-101
• Semaphorin-4B / Homo sapiens
  •        Asn-69
• Serum paraoxonase/arylesterase 1 / Homo sapiens
  •        Asn-253
• Target of Nesh-SH3 / Homo sapiens
  •        Asn-259
• Trem-like transcript 2 protein / Homo sapiens
  •        Asn-89
• Tyrosine-protein kinase receptor UFO / Homo sapiens
  •        Asn-345
• Uromodulin / Homo sapiens
  •        Asn-232
  •        Asn-513
• WAP four-disulfide core domain protein 2 / Homo sapiens
  •        Asn-44
• Signal-regulatory protein alpha / Mus musculus
  •        Asn-312
• Alpha-1-acid glycoprotein / Ovis aries
  •        Undefined site
• Acetylcholine receptor protein / Torpedo californica
  •        Undefined site
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-165
  •        Asn-1098

Mass spectrometry observed peptide

• LVPVPITNATLDR (13aa)
  •    P19652    Asn-33     Alpha-1-acid glycoprotein 2 / Homo sapiens
• LVPVPITNATLDQITGK (17aa)
  •    P02763    Asn-33     Alpha-1-acid glycoprotein 1 / Homo sapiens
• MAYNMTFFPNLM (12aa)
  •    O60353    Asn-38     Frizzled-6 / Homo sapiens
• TAVNCSSDFDACLITK (16aa)
  •    P13987    Asn-43     CD59 glycoprotein / Homo sapiens
• TGVCPELQADQNCTQECVSDSECADNLK (28aa)
  •    Q14508    Asn-44     WAP four-disulfide core domain protein 2 / Homo sapiens
• WFSAGLASNSSWLR (14aa)
  •    P41222    Asn-51     Prostaglandin-h2 d-isomerase / Homo sapiens
• SLNENITVPDTK (12aa)
  •    P01588    Asn-65     Erythropoietin / Homo sapiens
• FEAEHISNYTALLLSR (16aa)
  •    Q9NPR2    Asn-69     Semaphorin-4B / Homo sapiens
• SVQEIQATFFYFTPNK (16aa)
  •    P19652    Asn-72     Alpha-1-acid glycoprotein 2 / Homo sapiens
  •    P02763    Asn-72     Alpha-1-acid glycoprotein 1 / Homo sapiens
• YFTPNKTEDTIFLR (14aa)
  •    P19652    Asn-72     Alpha-1-acid glycoprotein 2 / Homo sapiens
  •    P02763    Asn-72     Alpha-1-acid glycoprotein 1 / Homo sapiens
• QVHFFVNASDVDNVK (15aa)
  •    Q96IY4    Asn-73     Carboxypeptidase b2 / Homo sapiens
• VVNITMVALK (10aa)
  •    Q5T2D2    Asn-89     Trem-like transcript 2 protein / Homo sapiens
• QNQCFYNSSYLNVQR (15aa)
  •    P19652    Asn-93     Alpha-1-acid glycoprotein 2 / Homo sapiens
  •    P19652    Asn-88     Alpha-1-acid glycoprotein 2 / Homo sapiens
• RQDQCIYNTTYLNVQRE (17aa)
  •    P02763    Asn-93     Alpha-1-acid glycoprotein 1 / Homo sapiens
• QDQCIYNTTYLNVQR (15aa)
  •    P02763    Asn-93     Alpha-1-acid glycoprotein 1 / Homo sapiens
• ENDTHCIDFSYLLYSQK (17aa)
  •    Q15262    Asn-101     Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
• FNLTETSEAEIHQSFQHLLR (20aa)
  •    P01011    Asn-106     Alpha-1-antichymotrypsin / Homo sapiens
• ADTHDEILEGLNFNLTEIPEAQIHEGFQELLR (32aa)
  •    P01009    Asn-107     Alpha-1-antitrypsin / Homo sapiens
• GHVNITR (7aa)
  •    P00734    Asn-121     Prothrombin / Homo sapiens
• NNSIYVVANIGDK (13aa)
  •    O95497    Asn-130     Pantetheinase / Homo sapiens
• EHEGAIYPDNTTDFQR (16aa)
  •    P00450    Asn-138     Ceruloplasmin / Homo sapiens
• IPNNTQWVTWSPVGHK (16aa)
  •    P27487    Asn-150     Dipeptidyl peptidase 4 / Homo sapiens
• VYSSANNCTFE (11aa)
  •    P0DTC2    Asn-165     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• HGIQYFNNNTQHSSLFTLNEVK (22aa)
  •    P01042    Asn-169     Kininogen-1 / Homo sapiens
  •    VAR_019278   178:M→T   dbSNP:rs1656922
• VQNVTEFDDSLLR (13aa)
  •    Q9NZK5    Asn-174     Adenosine deaminase 2 / Homo sapiens
• NIQNNVSCYLEGK (13aa)
  •    Q99650    Asn-176     Oncostatin-M-specific receptor subunit beta / Homo sapiens
• LPPGLLANFTLLR (13aa)
  •    P02750    Asn-186     Leucine-rich alpha-2-glycoprotein / Homo sapiens
• ALPGNLTAAVMEANQTGHEFPDR (23aa)
  •    Q9H8L6    Asn-205     Multimerin-2 / Homo sapiens
• KNLFLNHSENATAKD (15aa)
  •    P00738    Asn-211     Haptoglobin / Homo sapiens
  •    P00738    Asn-207     Haptoglobin / Homo sapiens
• CNTAAPMWLNGTHPSSDEGIVSR (23aa)
  •    P07911    Asn-232     Uromodulin / Homo sapiens
• VVLHPNYSQVDIGLIK (16aa)
  •    P00738    Asn-241     Haptoglobin / Homo sapiens
• KVVLHPNYSQVDIGLIKL (18aa)
  •    P00738    Asn-241     Haptoglobin / Homo sapiens
• TTEFDTNSTDIALK (14aa)
  •    Q9HBW9    Asn-249     Adhesion G protein-coupled receptor L4 / Homo sapiens
• HANWTLTPLK (10aa)
  •    P27169    Asn-253     Serum paraoxonase/arylesterase 1 / Homo sapiens
• QVIQNVTHK (9aa)
  •    Q7Z7G0    Asn-259     Target of Nesh-SH3 / Homo sapiens
• VVGVPYQGNATALFILPSEGK (21aa)
  •    P05154    Asn-262     Plasma serine protease inhibitor / Homo sapiens
• KYTGNASALFILPDQDKM (18aa)
  •    P01011    Asn-271     Alpha-1-antichymotrypsin / Homo sapiens
• DTCPPLMLYNPTTYQMDVNPEGK (23aa)
  •    P00533    Asn-271     Epidermal growth factor receptor / Homo sapiens
• YTGNASALFILPDQDK (16aa)
  •    P01011    Asn-271     Alpha-1-antichymotrypsin / Homo sapiens
• THTNISESHPNATFSAVGEASICEDDWDSGER (32aa)
  •    P01871    Asn-272     Immunoglobulin heavy constant mu / Homo sapiens
• NTDGTYNYTSLFLVNSSAHREDVVFTCQVK (30aa)
  •    P97797    Asn-312     Signal-regulatory protein alpha / Mus musculus
• NGSQAFVHWQEPR (13aa)
  •    P30530    Asn-345     Tyrosine-protein kinase receptor UFO / Homo sapiens
• LYLGSNNLTALHPALFQNLSK (21aa)
  •    P22792    Asn-348     Carboxypeptidase N subunit 2 / Homo sapiens
• NILDALMLNTTR (12aa)
  •    Q9NZK5    Asn-378     Adenosine deaminase 2 / Homo sapiens
• GLNLTEDTYKPR (12aa)
  •    Q08380    Asn-398     Galectin-3-binding protein / Homo sapiens
• IDSTGNVTNELR (12aa)
  •    O75882    Asn-416     Attractin / Homo sapiens
• FALLMTNCYATPSSNATDPLK (21aa)
  •    P07911    Asn-513     Uromodulin / Homo sapiens
• ALSQQNVSMDLATFMK (16aa)
  •    Q13421    Asn-523     Mesothelin / Homo sapiens
• INNLTVSLEMEK (12aa)
  •    Q13201    Asn-576     Multimerin-1 / Homo sapiens
• ELHHLQEQNVSNAFLDK (17aa)
  •    P00450    Asn-762     Ceruloplasmin / Homo sapiens
• ILGTEEPSNVTVK (13aa)
  •    O43451    Asn-912     Maltase-glucoamylase, intestinal / Homo sapiens
• EGVFVSNGTHWFVTQR (16aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NETHNPTVK (9aa)
  •    P08581    Asn-1171     Hepatocyte growth factor receptor / Homo sapiens
• ALLTNVSSVALGSR (14aa)
  •    Q7Z7M0    Asn-1271     Multiple epidermal growth factor-like domains protein 8 / Homo sapiens
• MLWEHNSTIIVMLTK (15aa)
  •    P10586    Asn-1731     Receptor-type tyrosine-protein phosphatase F / Homo sapiens
• NESGIILLGSGGTPAPPR (18aa)
  •    P24043    Asn-2558     Laminin subunit alpha-2 / Homo sapiens
• TAIFAFNISHVSNK (14aa)
  •    P35555    Asn-2767     Fibrillin-1 / Homo sapiens
• TPENYPNAGLTENYCR (16aa)
  •    P08519    Asn-4057     Apolipoprotein (a) / Homo sapiens