GlyConnect

taxonomy (12) protein (17) source (11) structure (11) composition (1) disease (1) reference (19) site (17) peptide (1)

Taxonomy

Protein

Source

Reported structure

Composition

Hex:3 HexNAc:2 dHex:2 (avg mass : 1203.1185 )

Disease

Ovarian cyst (DOID:5119)

Reference

N-glycan structures of squid rhodopsin. Existence of the alpha1-3 and alpha1-6 difucosylated innermost GlcNAc residue in a molluscan glycoprotein. (2003 - Takahashi N, Masuda K, Hiraki K, Yoshihara K, Huang HH, Khoo KH, Kato K) / Status : Reviewed
N-linked glycan structures of mouse interferon-beta produced by Bombyx mori larvae. (2003 - Misaki R, Nagaya H, Fujiyama K, Yanagihara I, Honda T, Seki T) / Status : Reviewed
Structural analysis of N-linked glycans in Caenorhabditis elegans (2002 - Natsuka S, Adachi J, Kawaguchi M, Nakakita S, Hase S, Ichikawa A, Ikura K) / Status : Reviewed
The expression of free oligosaccharides in human seminal plasma. (2002 - Chalabi S, Easton RL, Patankar MS, Lattanzio FA, Morrison JC, Panico M, Morris HR, Dell A, Clark GF) / Status : Reviewed
Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
O-glycan variability of egg-jelly mucins from Xenopus laevis: characterization of four phenotypes that differ by the terminal glycosylation of their mucins (2000 - Guerardel, Kol, Maes, Lefebvre, Boilly, Davril, Strecker) / Status : Reviewed
Aah VI, a novel, N-glycosylated anti-insect toxin from Androctonus australis hector scorpion venom: isolation, characterisation, and glycan structure determination. (1999 - Hassani O, Loew D, Van Dorsselaer A, Papandrou M, Sorokine O, Rochat H, Sampieri F, Mansuelle P) / Status : Reviewed
Structural analysis of hexa to dodecaoligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Bufo bufo. (1997 - Morelle W, Strecker G) / Status : Reviewed
Characterization of neutral oligosaccharide-alditols from Xenopus laevis egg jelly coats by matrix-assisted laser desorption Fourier transform mass spectrometry. (1997 - Tseng K, Lindsay L, Penn S, Hedrick J, Lebrilla C) / Status : Reviewed
Differential N-glycan patterns of secreted and intracellular IgG produced in Trichoplusia ni cells. (1997 - Hsu T, Takahashi N, Tsukamoto Y, Kato K, Shimada I, Masuda K, Whiteley E, Fan J, Lee Y, Betenbaugh M) / Status : Reviewed
The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
Primary structure of 12 neutral oligosaccharide-alditols released from the jelly coats of the anuran Xenopus laevis by reductive beta-elimination. (1995 - Strecker G, Wieruszeski J, Plancke Y, Boilly B) / Status : Reviewed
Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
Alpha 1-6(alpha 1-3)-difucosylation of the asparagine-bound N-acetylglucosamine in honeybee venom phospholipase A2. (1992 - Staudacher E, Altmann F, Marz L, Hard K, Kamerling J, Vliegenthart J) / Status : Reviewed
Structural analysis of the oligosaccahrides of ovarian cyst fluid mucins from a patient with blood-group B. (1991 - Strang AM, Ceiler D, Dube V, Van Halbeek H) / Status : Reviewed
Immunochemical studies on blood groups. Structures and immunochemical properties of oligosaccharides from two fractions of blood group substance from human ovarian cyst fluid differing in B, I, and i activities and reactivity toward concanavalin A. (1976 - Maisonrouge-McAuliffe F, Kabat E) / Status : Reviewed

Reported glycosite

Latent transforming growth factor beta binding protein 1 / Homo sapiens
- Asn-1366
Mucin / Homo sapiens
- Undefined site
Serotransferrin / Homo sapiens
- Undefined site
Uncharacterized protein from Fluid / Homo sapiens
- Undefined site
Immunoglobulin gamma-2a heavy chain / Mus musculus
- Undefined site
Interferon beta / Mus musculus
- Undefined site
Mucin / Bufo bufo
- Undefined site
Mucin / Xenopus laevis
- Undefined site
Toxin Aah6 / Androctonus australis hector
- Asn-9
Rhodopsin / Todarodes pacificus
- Undefined site
Uncharacterized protein from Crude Membrane Fraction / Caenorhabditis elegans
- Undefined site
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
Phospholipase a2 / Apis mellifera
- Asn-46
Membrane glycoproteins / Bombyx mori
- Undefined site
Uncharacterized protein from Undefined tissue / Drosophila melanogaster
- Undefined site
Membrane glycoproteins / Mamestra brassicae
- Undefined site
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site

Mass spectrometry observed peptide

CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
- Q14766 Asn-1366

- O-Linked / Core 2 (avg mass : 1203.1185)
- O-Linked / Core 2 (avg mass : 1203.1185)
- Free / No-core (avg mass : 1203.1185)
- Free / No-core (avg mass : 1203.1185)
- Free / No-core (avg mass : 1203.1185)
- Free / No-core (avg mass : 1203.1185)
- O-Linked / Core 2 (avg mass : 1203.1185)
- O-Linked / Core 1 (avg mass : 1203.1185)
- N-Linked / Pauci-Mannose (avg mass : 1203.1185)
- N-Linked / No-core (avg mass : 1203.1185)
- N-Linked / No-core (avg mass : 1203.1185)