taxonomy (13)
protein (21)
source (14)
structure (13)
composition (1)
disease (2)
reference (24)
site (33)
peptide (17)
- Homo sapiens (Human)
- Mus musculus (House mouse)
- Bufo bufo (European toad)
- Xenopus laevis (African clawed frog)
- Androctonus australis hector (Sahara scorpion)
- Todarodes pacificus (Japanese flying squid)
- Caenorhabditis elegans
- Apis mellifera (Honeybee)
- Bombyx mori (Domestic silkworm)
- Drosophila melanogaster (Fruit fly)
- Mamestra brassicae
- Spodoptera frugiperda (Fall armyworm)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Lactadherin / Homo sapiens Q08431
- Latent transforming growth factor beta binding protein 1 / Homo sapiens Q14766
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Serotransferrin / Homo sapiens P02787
- Uncharacterized protein from Ovary / Homo sapiens
- Unspecified mucin / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Immunoglobulin gamma-2a heavy chain / Mus musculus
- Interferon beta / Mus musculus P01575
- Mucin / Bufo bufo
- Mucin / Xenopus laevis
- Toxin Aah6 / Androctonus australis hector P56743
- Rhodopsin / Todarodes pacificus P31356
- Uncharacterized protein / Caenorhabditis elegans
- Hyaluronoglucosaminidase / Apis mellifera Q08169
- Phospholipase a2 / Apis mellifera P00630
- Membrane glycoproteins / Bombyx mori
- Uncharacterized protein / Drosophila melanogaster
- Membrane glycoproteins / Mamestra brassicae
- Membrane glycoproteins / Spodoptera frugiperda
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Embryo (UBERON_0000922)
- Hemolymph (UBERON_0001011)
- Milk (UBERON_0001913)
- Ovarian mucosa
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Ovary (UBERON_0000992)
- Retina (UBERON_0000966) Plasma Membrane (GO_0005886)
- Seminal Fluid (UBERON_0006530)
- Venom (UBERON_0007113)
- BM-N (CVCL_Z633)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- BTI-Tn-5B1-4 (CVCL_C190)
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
- Egg Cell Jelly Coat
Source
- Free / Lactose / GalNAc(a1-3)[Fuc(a1-2)]Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)Gal(b1-4)Glc(b1-
- Free / No-core / Fuc(a1-2)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Glc
- Free / No-core / Fuc(a1-2)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-4)Glc
- Free / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Glc
- Free / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-4)Glc
- N-Linked / No-core / Man(a1-3)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)][Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Gal(b1-4)Fuc(a1-6)][Fuc(a1-3)]GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)][Fuc(a1-6)]GlcNAc
- N-Linked / Pauci-Mannose / Structure 9449
- O-Linked / Core 1 / Gal(a1-3)GalNAc(a1-3)[Fuc(a1-2)]Gal(b1-3)[Fuc(a1-2)]Gal(b1-3)GalNAc
- O-Linked / Core 2 / Fuc(a1-2)[Gal(a1-3)]Gal(b1-4)GlcNAc(b1-6)[Fuc(a1-2)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)[Gal(a1-4)]Gal(b1-3)[Fuc(a1-2)]Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Gal(a1-3)GalNAc(a1-3)[Fuc(a1-2)]Gal(b1-3)[Fuc(a1-2)][GlcNAc(b1-6)]Gal
Reported structure
- Hex:3 HexNAc:2 dHex:2 (avg mass : 1203.1185 )
Composition
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Development of an Annotated Library of Neutral Human Milk Oligosaccharides (2010 - Shuai Wu, Nannan Tao, J Bruce German, Rudolf Grimm, Carlito B Lebrilla) / Status : Reviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
- N-glycan structures of squid rhodopsin. Existence of the alpha1-3 and alpha1-6 difucosylated innermost GlcNAc residue in a molluscan glycoprotein. (2003 - Takahashi N, Masuda K, Hiraki K, Yoshihara K, Huang HH, Khoo KH, Kato K) / Status : Reviewed
- N-linked glycan structures of mouse interferon-beta produced by Bombyx mori larvae. (2003 - Misaki R, Nagaya H, Fujiyama K, Yanagihara I, Honda T, Seki T) / Status : Reviewed
- The expression of free oligosaccharides in human seminal plasma. (2002 - Chalabi S, Easton RL, Patankar MS, Lattanzio FA, Morrison JC, Panico M, Morris HR, Dell A, Clark GF) / Status : Reviewed
- Structural analysis of N-linked glycans in Caenorhabditis elegans (2002 - Natsuka S, Adachi J, Kawaguchi M, Nakakita S, Hase S, Ichikawa A, Ikura K) / Status : Reviewed
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
- O-glycan variability of egg-jelly mucins from Xenopus laevis: characterization of four phenotypes that differ by the terminal glycosylation of their mucins (2000 - Guerardel, Kol, Maes, Lefebvre, Boilly, Davril, Strecker) / Status : Reviewed
- N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- Aah VI, a novel, N-glycosylated anti-insect toxin from Androctonus australis hector scorpion venom: isolation, characterisation, and glycan structure determination. (1999 - Hassani O, Loew D, Van Dorsselaer A, Papandrou M, Sorokine O, Rochat H, Sampieri F, Mansuelle P) / Status : Reviewed
- Differential N-glycan patterns of secreted and intracellular IgG produced in Trichoplusia ni cells. (1997 - Hsu T, Takahashi N, Tsukamoto Y, Kato K, Shimada I, Masuda K, Whiteley E, Fan J, Lee Y, Betenbaugh M) / Status : Reviewed
- Structural analysis of hexa to dodecaoligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Bufo bufo. (1997 - Morelle W, Strecker G) / Status : Reviewed
- Characterization of neutral oligosaccharide-alditols from Xenopus laevis egg jelly coats by matrix-assisted laser desorption Fourier transform mass spectrometry. (1997 - Tseng K, Lindsay L, Penn S, Hedrick J, Lebrilla C) / Status : Reviewed
- The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
- Primary structure of 12 neutral oligosaccharide-alditols released from the jelly coats of the anuran Xenopus laevis by reductive beta-elimination. (1995 - Strecker G, Wieruszeski J, Plancke Y, Boilly B) / Status : Reviewed
- Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
- Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Alpha 1-6(alpha 1-3)-difucosylation of the asparagine-bound N-acetylglucosamine in honeybee venom phospholipase A2. (1992 - Staudacher E, Altmann F, Marz L, Hard K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structural analysis of the oligosaccahrides of ovarian cyst fluid mucins from a patient with blood-group B. (1991 - Strang AM, Ceiler D, Dube V, Van Halbeek H) / Status : Reviewed
- Immunochemical studies on blood groups. Structures and immunochemical properties of oligosaccharides from two fractions of blood group substance from human ovarian cyst fluid differing in B, I, and i activities and reactivity toward concanavalin A. (1976 - Maisonrouge-McAuliffe F, Kabat E) / Status : Reviewed
Reference
- Lactadherin / Homo sapiens
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
-
Serotransferrin / Homo sapiens
- Undefined site
-
Uncharacterized protein from Ovary / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
- Zinc-alpha-2-glycoprotein / Homo sapiens
-
Immunoglobulin gamma-2a heavy chain / Mus musculus
- Undefined site
-
Interferon beta / Mus musculus
- Undefined site
-
Mucin / Bufo bufo
- Undefined site
-
Mucin / Xenopus laevis
- Undefined site
- Toxin Aah6 / Androctonus australis hector
-
Rhodopsin / Todarodes pacificus
- Undefined site
-
Uncharacterized protein / Caenorhabditis elegans
- Undefined site
-
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
- Phospholipase a2 / Apis mellifera
-
Membrane glycoproteins / Bombyx mori
- Undefined site
-
Uncharacterized protein / Drosophila melanogaster
- Undefined site
-
Membrane glycoproteins / Mamestra brassicae
- Undefined site
-
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- VNLTTR (6aa)
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- KDIVEYYNDSNGSHVLQGRF (20aa)
- TQSLLIVNNATNVVIK (16aa)
- VYSSANNCTFE (11aa)
- NGTITDAVDCALDPLSE (17aa)
- KVAYSNDSANWTEYQDPRT (19aa)
- FPNITNLCPFGE (12aa)
- VFNATR (6aa)
- AGCLIGAEHVNNSYE (15aa)
- HVNNSYE (7aa)
- DFGGFNFSQILPDPSKPSK (19aa)
- KNFTTAPAICHDGK (14aa)
- NFTTAPAICHDGK (13aa)
- GVFVSNGTHWFVTQR (15aa)
- NHTSPDVDLGDISGINASVVNIQK (24aa)
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
Mass spectrometry observed peptide
-
- Free / Lactose
(avg mass : 1203.1185)
- Milk (UBERON_0001913)
-
- Free / No-core
(avg mass : 1203.1185)
- Seminal Fluid (UBERON_0006530)
-
- Free / No-core
(avg mass : 1203.1185)
- Seminal Fluid (UBERON_0006530)
-
- Free / No-core
(avg mass : 1203.1185)
- Seminal Fluid (UBERON_0006530)
-
- Free / No-core
(avg mass : 1203.1185)
- Seminal Fluid (UBERON_0006530)
-
- N-Linked / No-core
(avg mass : 1203.1185)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
-
Immunoglobulin gamma-2a heavy chain / Mus musculus
- Undefined site
-
- N-Linked / No-core
(avg mass : 1203.1185)
-
Rhodopsin / Todarodes pacificus
- Undefined site
-
- N-Linked / Pauci-Mannose
(avg mass : 1203.1185)
- Embryo (UBERON_0000922)
- Hemolymph (UBERON_0001011)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Retina (UBERON_0000966) Plasma Membrane (GO_0005886)
- Venom (UBERON_0007113)
- BM-N (CVCL_Z633)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- BTI-Tn-5B1-4 (CVCL_C190)
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
- COVID-19 (DOID:0080600)
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
- N-glycan structures of squid rhodopsin. Existence of the alpha1-3 and alpha1-6 difucosylated innermost GlcNAc residue in a molluscan glycoprotein. (2003 - Takahashi N, Masuda K, Hiraki K, Yoshihara K, Huang HH, Khoo KH, Kato K) / Status : Reviewed
- N-linked glycan structures of mouse interferon-beta produced by Bombyx mori larvae. (2003 - Misaki R, Nagaya H, Fujiyama K, Yanagihara I, Honda T, Seki T) / Status : Reviewed
- Structural analysis of N-linked glycans in Caenorhabditis elegans (2002 - Natsuka S, Adachi J, Kawaguchi M, Nakakita S, Hase S, Ichikawa A, Ikura K) / Status : Reviewed
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
- N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- Aah VI, a novel, N-glycosylated anti-insect toxin from Androctonus australis hector scorpion venom: isolation, characterisation, and glycan structure determination. (1999 - Hassani O, Loew D, Van Dorsselaer A, Papandrou M, Sorokine O, Rochat H, Sampieri F, Mansuelle P) / Status : Reviewed
- The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
- Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
- Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Alpha 1-6(alpha 1-3)-difucosylation of the asparagine-bound N-acetylglucosamine in honeybee venom phospholipase A2. (1992 - Staudacher E, Altmann F, Marz L, Hard K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
-
Serotransferrin / Homo sapiens
- Undefined site
-
Interferon beta / Mus musculus
- Undefined site
- Toxin Aah6 / Androctonus australis hector
-
Rhodopsin / Todarodes pacificus
- Undefined site
-
Uncharacterized protein / Caenorhabditis elegans
- Undefined site
-
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
- Phospholipase a2 / Apis mellifera
-
Membrane glycoproteins / Bombyx mori
- Undefined site
-
Uncharacterized protein / Drosophila melanogaster
- Undefined site
-
Membrane glycoproteins / Mamestra brassicae
- Undefined site
-
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- VNLTTR (6aa)
- TQSLLIVNNATNVVIK (16aa)
- VYSSANNCTFE (11aa)
- NGTITDAVDCALDPLSE (17aa)
- FPNITNLCPFGE (12aa)
- VFNATR (6aa)
- AGCLIGAEHVNNSYE (15aa)
- HVNNSYE (7aa)
- DFGGFNFSQILPDPSKPSK (19aa)
- KNFTTAPAICHDGK (14aa)
- NFTTAPAICHDGK (13aa)
- GVFVSNGTHWFVTQR (15aa)
- NHTSPDVDLGDISGINASVVNIQK (24aa)
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
-
- N-Linked / Pauci-Mannose
(avg mass : 1203.1185)
- Milk (UBERON_0001913)
- Lactadherin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- KDIVEYYNDSNGSHVLQGRF (20aa)
- KVAYSNDSANWTEYQDPRT (19aa)
-
- O-Linked / Core 1
(avg mass : 1203.1185)
- Egg Cell Jelly Coat
-
Mucin / Bufo bufo
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1203.1185)
- Ovarian mucosa
- Ovary (UBERON_0000992)
- Ovarian cyst (DOID:5119)
- Structural analysis of the oligosaccahrides of ovarian cyst fluid mucins from a patient with blood-group B. (1991 - Strang AM, Ceiler D, Dube V, Van Halbeek H) / Status : Reviewed
- Immunochemical studies on blood groups. Structures and immunochemical properties of oligosaccharides from two fractions of blood group substance from human ovarian cyst fluid differing in B, I, and i activities and reactivity toward concanavalin A. (1976 - Maisonrouge-McAuliffe F, Kabat E) / Status : Reviewed
-
Uncharacterized protein from Ovary / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1203.1185)
- Egg Cell Jelly Coat
- O-glycan variability of egg-jelly mucins from Xenopus laevis: characterization of four phenotypes that differ by the terminal glycosylation of their mucins (2000 - Guerardel, Kol, Maes, Lefebvre, Boilly, Davril, Strecker) / Status : Reviewed
- Characterization of neutral oligosaccharide-alditols from Xenopus laevis egg jelly coats by matrix-assisted laser desorption Fourier transform mass spectrometry. (1997 - Tseng K, Lindsay L, Penn S, Hedrick J, Lebrilla C) / Status : Reviewed
- Primary structure of 12 neutral oligosaccharide-alditols released from the jelly coats of the anuran Xenopus laevis by reductive beta-elimination. (1995 - Strecker G, Wieruszeski J, Plancke Y, Boilly B) / Status : Reviewed
-
Mucin / Xenopus laevis
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1203.1185)
- O-Linked / Core 2
(avg mass : 1203.1185)
Source
Reference
Reported glycosite
- O-Linked / Core 2
(avg mass : 1203.1185)
Source
Disease
Reference
Reported glycosite
- O-Linked / Core 2
(avg mass : 1203.1185)
Source
Reported glycosite
- O-Linked / Core 1
(avg mass : 1203.1185)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Pauci-Mannose
(avg mass : 1203.1185)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Pauci-Mannose
(avg mass : 1203.1185)
Reported glycosite
- N-Linked / No-core
(avg mass : 1203.1185)
Source
Reported glycosite
- N-Linked / No-core
(avg mass : 1203.1185)
Source
Reported glycosite
- Free / No-core
(avg mass : 1203.1185)
Source
Reported glycosite
- Free / No-core
(avg mass : 1203.1185)
Source
Reported glycosite
- Free / No-core
(avg mass : 1203.1185)
Source
Reported glycosite
- Free / No-core
(avg mass : 1203.1185)
Source
Reported glycosite
- Free / Lactose
(avg mass : 1203.1185)