GlyConnect

taxonomy (5) protein (14) source (9) structure (14) composition (1) disease (3) reference (14) site (14) peptide (2)

Taxonomy

Protein

Source

Reported structure

Composition

Hex:3 HexNAc:4 dHex:2 (avg mass : 1609.5085 )

Disease

Reference

Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
Structural analysis of a new series of oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Rana utricularia. (1998 - Morelle W, Strecker G) / Status : Reviewed
Structural analysis of hexa to dodecaoligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Bufo bufo. (1997 - Morelle W, Strecker G) / Status : Reviewed
The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
Quantitation and structures of oligosaccharide chains in human trachea mucin glycoproteins. (1992 - Sangadala S, Bhat U, Mendicino J) / Status : Reviewed
Isolation and structural characterization of novel neutral oligosaccharide-alditols from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis. 1. Structure of 11 oligosaccharides having the GlcNAc beta(1---3)Gal beta(1---4)GlcNAc beta(1---6)GalNAc-ol structural element in commo (1991 - Klein A, Carnoy C, Lamblin G, Roussel P, van Kuik J, de Waard P, Vliegenthart J) / Status : Reviewed
Isolation and structural characterization of novel neutral oligosaccharide-alditols from respitatory-mucus glycoproteins of a patient suffering from bronchiectasis. 2. Structure of twelve hepta-to-nonasaccharide, six of which possess the GlcNAc beta(1----3)[Gal beta(1----4)GlcNAc beta(1----6)]Gal be (1991 - van Kuik J, de Waard P, Vliegenthart J, Klein A, Carnoy C, Lamblin G, Roussel P) / Status : Reviewed
Structures of the oligosaccharide chains in swine trachea mucin glycoproteins. (1984 - Chandrasekaran EV, Rana SS, Davila M, Mendicino J) / Status : Reviewed
Structural characterization of neutral oligosaccharides of human H+Leb+ gastric mucin. (1984 - Slomiany B, Zdebska E, Slomiany A) / Status : Reviewed
Characterization of the primary structure and the microheterogeneity of the carbohydrate chains of porcine blood-group H substance by 500-MHz 1H-NMR spectroscopy. (1982 - van Halbeek H, Dorland L, Vliegenthart J, Kochetkov N, Arbatsky N, Derevitskaya V) / Status : Reviewed

Reported glycosite

CD59 glycoprotein / Homo sapiens
- Thr-105
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Asn-180
Immunoglobulin heavy constant gamma 4 / Homo sapiens
- Asn-177
Immunoglobulin heavy constant mu / Homo sapiens
- Asn-439
Latent transforming growth factor beta binding protein 1 / Homo sapiens
- Asn-1366
Mucin / Homo sapiens
- Undefined site
Major seminal plasma glycoprotein psp-i / Sus scrofa
- Asn-71
Major seminal plasma glycoprotein psp-ii / Sus scrofa
- Asn-119
Mucin / Sus scrofa
- Undefined site
Uncharacterized protein from Epithelium of Stomach / Sus scrofa
- Undefined site
Mucin / Bufo bufo
- Undefined site
Mucin / Rana utricularia
- Undefined site
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
Phospholipase a2 / Apis mellifera
- Asn-46

Mass spectrometry observed peptide

DLCNFNEQLENGGTSLSEK (19aa)
- P13987 Thr-105
CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
- Q14766 Asn-1366

- O-Linked / Core 2 (avg mass : 1609.5085)
- O-Linked / Core 4 (avg mass : 1609.5085)
- O-Linked / Core 2 (avg mass : 1609.5085)
- O-Linked / Core 2 (avg mass : 1609.5085)
- O-Linked / Core 2 (avg mass : 1609.5085)
- O-Linked / Core 2 (avg mass : 1609.5085)
- O-Linked / Core 2 (avg mass : 1609.5085)
- O-Linked / Core 4 (avg mass : 1609.5085)
- O-Linked / Core 4 (avg mass : 1609.5085)
- N-Linked / Complex (avg mass : 1609.5085)
- N-Linked / Complex (avg mass : 1609.5085)
- O-Linked / Core 2 (avg mass : 1609.5085)
- O-Linked / Core 2 (avg mass : 1609.5085)
- N-Linked / Complex (avg mass : 1609.5085)

- Hex:3 HexNAc:4 dHex:2 / N-Linked (avg mass : 1609.5085)
- Hex:3 HexNAc:4 dHex:2 / O-Linked (avg mass : 1609.5085)