taxonomy (7)
protein (16)
source (13)
structure (17)
composition (1)
disease (4)
reference (18)
site (18)
peptide (7)
- Homo sapiens (Human)
- Sus scrofa (Pig)
- Bufo bufo (European toad)
- Rana utricularia
- Apis mellifera (Honeybee)
- Drosophila melanogaster (Fruit fly)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- CD59 glycoprotein / Homo sapiens P13987
- Immunoglobulin heavy constant gamma 1 / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 4 / Homo sapiens P01861
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Latent transforming growth factor beta binding protein 1 / Homo sapiens Q14766
- Unspecified mucin / Homo sapiens
- Major seminal plasma glycoprotein psp-i / Sus scrofa P35495
- Major seminal plasma glycoprotein psp-ii / Sus scrofa P35496
- Mucin / Sus scrofa
- Uncharacterized protein from Epithelium of Stomach / Sus scrofa
- Mucin / Bufo bufo
- Mucin / Rana utricularia
- Hyaluronoglucosaminidase / Apis mellifera Q08169
- Phospholipase a2 / Apis mellifera P00630
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Blood Serum (UBERON_0001977)
- Embryo (UBERON_0000922)
- Epithelium of Stomach (UBERON_0001276)
- Milk (UBERON_0001913)
- Mucosa of Stomach (UBERON_0001199)
- Pulmonary Mucosa
- Seminal Fluid (UBERON_0006530)
- Urine (UBERON_0001088)
- Venom (UBERON_0007113)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- BTI-Tn-5B1-4 (CVCL_C190)
- FreeStyle 293-F (CVCL_D603)
- Egg Cell Jelly Coat
Source
- N-Linked / Complex / Fuc(a1-3)[GalNAc(b1-4)]GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)]GlcNAc
- N-Linked / Complex / Fuc(a1-3)[GalNAc(b1-4)]GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-?)Man(a1-3)[GlcNAc(b1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)][Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9501
- N-Linked / Hybrid / Structure 9707
- N-Linked / Hybrid / Structure 9783
- O-Linked / Core 2 / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-?)GlcNAc(b1-3)Gal(b1-3)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)Gal(b1-3)[Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-3)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-3)[GlcNAc(b1-6)]Gal(b1-3)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)]GlcNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-?)GlcNAc(b1-3)[Fuc(a1-2)Gal(b1-?)GlcNAc(b1-6)]Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Gal(a1-3)GalNAc(a1-3)[Fuc(a1-2)]Gal(b1-3)[Fuc(a1-2)][GlcNAc(b1-6)]Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Gal(b1-3)GlcNAc(a1-3)[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-6)[Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-3)]GalNAc
- O-Linked / Core 4 / Fuc(a1-2)Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-4)GlcNAc(b1-3)]GalNAc
- O-Linked / Core 4 / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)]GalNAc
- O-Linked / Core 4 / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-3)]GalNAc
Reported structure
- Hex:3 HexNAc:4 dHex:2 (avg mass : 1609.5085 )
Composition
- Bronchiectasis, due to Kartagener's Syndrome
- COVID-19 (DOID:0080600)
- Cystic Fibrosis (DOID:1485)
- Prostate cancer (DOID:10283)
Disease
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
- Structural analysis of a new series of oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Rana utricularia. (1998 - Morelle W, Strecker G) / Status : Reviewed
- Structural analysis of hexa to dodecaoligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Bufo bufo. (1997 - Morelle W, Strecker G) / Status : Reviewed
- The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
- Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Quantitation and structures of oligosaccharide chains in human trachea mucin glycoproteins. (1992 - Sangadala S, Bhat U, Mendicino J) / Status : Reviewed
- Isolation and structural characterization of novel neutral oligosaccharide-alditols from respitatory-mucus glycoproteins of a patient suffering from bronchiectasis. 2. Structure of twelve hepta-to-nonasaccharide, six of which possess the GlcNAc beta(1----3)[Gal beta(1----4)GlcNAc beta(1----6)]Gal be (1991 - van Kuik J, de Waard P, Vliegenthart J, Klein A, Carnoy C, Lamblin G, Roussel P) / Status : Reviewed
- Isolation and structural characterization of novel neutral oligosaccharide-alditols from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis. 1. Structure of 11 oligosaccharides having the GlcNAc beta(1---3)Gal beta(1---4)GlcNAc beta(1---6)GalNAc-ol structural element in commo (1991 - Klein A, Carnoy C, Lamblin G, Roussel P, van Kuik J, de Waard P, Vliegenthart J) / Status : Reviewed
- Structures of the oligosaccharide chains in swine trachea mucin glycoproteins. (1984 - Chandrasekaran EV, Rana SS, Davila M, Mendicino J) / Status : Reviewed
- Structural characterization of neutral oligosaccharides of human H+Leb+ gastric mucin. (1984 - Slomiany B, Zdebska E, Slomiany A) / Status : Reviewed
- Characterization of the primary structure and the microheterogeneity of the carbohydrate chains of porcine blood-group H substance by 500-MHz 1H-NMR spectroscopy. (1982 - van Halbeek H, Dorland L, Vliegenthart J, Kochetkov N, Arbatsky N, Derevitskaya V) / Status : Reviewed
Reference
- CD59 glycoprotein / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
-
Unspecified mucin / Homo sapiens
- Undefined site
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
Mucin / Sus scrofa
- Undefined site
-
Uncharacterized protein from Epithelium of Stomach / Sus scrofa
- Undefined site
-
Mucin / Bufo bufo
- Undefined site
-
Mucin / Rana utricularia
- Undefined site
-
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
- Phospholipase a2 / Apis mellifera
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- QCVNLTTR (8aa)
- HAIHVSGTNGTK (12aa)
- DLCNFNEQLENGGTSLSEK (19aa)
- KTKPREEQYNSTYRV (15aa)
- RFPNIT (6aa)
- VPAQEKNFTTAPAICHDGK (19aa)
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 1609.5085)
- Venom (UBERON_0007113)
- The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
- Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
-
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
- Phospholipase a2 / Apis mellifera
-
- N-Linked / Complex
(avg mass : 1609.5085)
- Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
- The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
- Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
- Phospholipase a2 / Apis mellifera
-
- N-Linked / Complex
(avg mass : 1609.5085)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
-
- N-Linked / Complex
(avg mass : 1609.5085)
- Milk (UBERON_0001913)
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- KTKPREEQYNSTYRV (15aa)
-
- N-Linked / Hybrid
(avg mass : 1609.5085)
Released - Embryo (UBERON_0000922)
-
- N-Linked / Hybrid
(avg mass : 1609.5085)
Released - Embryo (UBERON_0000922)
-
- O-Linked / Core 2
(avg mass : 1609.5085)
- Pulmonary Mucosa
- Cystic Fibrosis (DOID:1485)
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1609.5085)
- Pulmonary Mucosa
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1609.5085)
- Pulmonary Mucosa
- Cystic Fibrosis (DOID:1485)
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1609.5085)
-
Uncharacterized protein from Epithelium of Stomach / Sus scrofa
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1609.5085)
- Pulmonary Mucosa
-
Mucin / Sus scrofa
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1609.5085)
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1609.5085)
- Egg Cell Jelly Coat
-
Mucin / Bufo bufo
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1609.5085)
- Egg Cell Jelly Coat
-
Mucin / Rana utricularia
- Undefined site
-
- O-Linked / Core 4
(avg mass : 1609.5085)
- Pulmonary Mucosa
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 4
(avg mass : 1609.5085)
- Pulmonary Mucosa
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 4
(avg mass : 1609.5085)
- Pulmonary Mucosa
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- Hex:3 HexNAc:4 dHex:2 / N-Linked
(avg mass : 1609.5085)
- N-Linked / Complex / Fuc(a1-3)[GalNAc(b1-4)]GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)]GlcNAc
- N-Linked / Complex / Fuc(a1-3)[GalNAc(b1-4)]GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-?)Man(a1-3)[GlcNAc(b1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)][Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9501
- N-Linked / Hybrid / Structure 9707
- N-Linked / Hybrid / Structure 9783
- COVID-19 (DOID:0080600)
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- QCVNLTTR (8aa)
- HAIHVSGTNGTK (12aa)
- RFPNIT (6aa)
- VPAQEKNFTTAPAICHDGK (19aa)
-
- Hex:3 HexNAc:4 dHex:2 / O-Linked
(avg mass : 1609.5085)
- Urine (UBERON_0001088)
- O-Linked / Core 2 / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-?)GlcNAc(b1-3)Gal(b1-3)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)Gal(b1-3)[Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-3)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-3)[GlcNAc(b1-6)]Gal(b1-3)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)]GlcNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-?)GlcNAc(b1-3)[Fuc(a1-2)Gal(b1-?)GlcNAc(b1-6)]Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Gal(a1-3)GalNAc(a1-3)[Fuc(a1-2)]Gal(b1-3)[Fuc(a1-2)][GlcNAc(b1-6)]Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Gal(b1-3)GlcNAc(a1-3)[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-6)[Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-3)]GalNAc
- O-Linked / Core 4 / Fuc(a1-2)Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-4)GlcNAc(b1-3)]GalNAc
- O-Linked / Core 4 / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)]GalNAc
- O-Linked / Core 4 / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-3)]GalNAc
- Prostate cancer (DOID:10283)
- CD59 glycoprotein / Homo sapiens
- DLCNFNEQLENGGTSLSEK (19aa)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:3 HexNAc:4 dHex:2 / O-Linked
(avg mass : 1609.5085)
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:3 HexNAc:4 dHex:2 / N-Linked
(avg mass : 1609.5085)
Source
Reported glycosite
- O-Linked / Core 4
(avg mass : 1609.5085)
Source
Reported glycosite
- O-Linked / Core 4
(avg mass : 1609.5085)
Source
Reported glycosite
- O-Linked / Core 4
(avg mass : 1609.5085)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1609.5085)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1609.5085)
Reported glycosite
- O-Linked / Core 2
(avg mass : 1609.5085)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1609.5085)
Reported glycosite
- O-Linked / Core 2
(avg mass : 1609.5085)
Source
Disease
Reported glycosite
- O-Linked / Core 2
(avg mass : 1609.5085)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1609.5085)
Source
Disease
Reported glycosite
- O-Linked / Core 2
(avg mass : 1609.5085)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1609.5085)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1609.5085)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1609.5085)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1609.5085)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1609.5085)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1609.5085)