Hex:6 HexNAc:5 dHex:1 NeuAc:2

Taxonomy

• Homo sapiens (Human)
• Desmodus rotundus (Common vampire bat)
• Mus musculus (House mouse)
• Rattus norvegicus (Norway rat)
• Sus scrofa (Pig)
• Gallus gallus (Chicken)
• Friend murine leukemia virus (F-mulv)
• Human immunodeficiency virus type 1 (HIV-1)
• Human betacoronavirus 2c EMC/2012
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• 4F2 cell-surface antigen heavy chain / Homo sapiens    P08195
• ADAM DEC1 / Homo sapiens    O15204
• Adenosine deaminase 2 / Homo sapiens    Q9NZK5
• Adhesion G protein-coupled receptor F5 / Homo sapiens    Q8IZF2
• Adhesion G protein-coupled receptor L4 / Homo sapiens    Q9HBW9
• Adhesion G-protein coupled receptor D1 / Homo sapiens    Q6QNK2
• Adipocyte enhancer-binding protein 1 / Homo sapiens    Q8IUX7
• Adipocyte plasma membrane-associated protein / Homo sapiens    Q9HDC9
• Alkaline phosphatase, tissue-nonspecific isozyme / Homo sapiens    P05186
• Alpha-1-acid glycoprotein 1 / Homo sapiens    P02763
• Alpha-1-acid glycoprotein 2 / Homo sapiens    P19652
• Alpha-1-antichymotrypsin / Homo sapiens    P01011
• Alpha-1-antitrypsin / Homo sapiens    P01009
• Alpha-2-HS-glycoprotein / Homo sapiens    P02765
• Alpha-2-macroglobulin / Homo sapiens    P01023
• Alpha-2-macroglobulin receptor-associated protein / Homo sapiens    P30533
• Alpha-n-acetylgalactosaminidase / Homo sapiens    P17050
• Alpha-S1-casein / Homo sapiens    P47710
• Angiopoietin-1 receptor / Homo sapiens    Q02763
• Angiotensin-converting enzyme / Homo sapiens    P12821
• Angiotensin-converting enzyme 2 / Homo sapiens    Q9BYF1
• Apolipoprotein (a) / Homo sapiens    P08519
• Apolipoprotein B-100 / Homo sapiens    P04114
• Apolipoprotein D / Homo sapiens    P05090
• Apolipoprotein F / Homo sapiens    Q13790
• Asialoglycoprotein receptor 2 / Homo sapiens    P07307
• Asporin / Homo sapiens    Q9BXN1
• Attractin / Homo sapiens    O75882
• Beta-2-glycoprotein 1 / Homo sapiens    P02749
• Beta-Ala-His dipeptidase / Homo sapiens    Q96KN2
• Biglycan / Homo sapiens    P21810
• Butyrophilin subfamily 1 member A1 / Homo sapiens    Q13410
• Cadherin-2 / Homo sapiens    P19022
• Cadherin-5 / Homo sapiens    P33151
• Carbonic anhydrase 6 / Homo sapiens    P23280
• Carboxypeptidase b2 / Homo sapiens    Q96IY4
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens    P06731
• Catalase / Homo sapiens    P04040
• Cation-independent mannose-6-phosphate receptor / Homo sapiens    P11717
• CD109 antigen / Homo sapiens    Q6YHK3
• CD166 antigen / Homo sapiens    Q13740
• CD276 antigen / Homo sapiens    Q5ZPR3
• CD44 antigen / Homo sapiens    P16070
• CD59 glycoprotein / Homo sapiens    P13987
• CD63 antigen / Homo sapiens    P08962
• Cell adhesion molecule 1 / Homo sapiens    Q9BY67
• Ceruloplasmin / Homo sapiens    P00450
• Chimeric plasminogen activator K2-tuPA / Homo sapiens    P00749    P00750
• Cholinesterase / Homo sapiens    P06276
• Clusterin / Homo sapiens    P10909
• Coagulation factor VIII / Homo sapiens    P00451
• Coagulation factor XI / Homo sapiens    P03951
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Collectin-12 / Homo sapiens    Q5KU26
• Complement c1r subcomponent / Homo sapiens    P00736
• Complement C2 / Homo sapiens    P06681
• Complement component c6 / Homo sapiens    P13671
• Complement factor h / Homo sapiens    P08603
• Complement factor i / Homo sapiens    P05156
• Contactin-1 / Homo sapiens    Q12860
• Contactin-3 / Homo sapiens    Q9P232
• Contactin-4 / Homo sapiens    Q8IWV2
• Corticotropin-releasing factor-binding protein / Homo sapiens    P24387
• Decorin / Homo sapiens    P07585
• Desmocollin-2 / Homo sapiens    Q02487
• Dipeptidyl peptidase 1 / Homo sapiens    P53634
• Dipeptidyl peptidase 4 / Homo sapiens    P27487
• Ecto-ADP-ribosyltransferase 4 / Homo sapiens    Q93070
• Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens    Q9Y5L3
• Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 / Homo sapiens    P22413
• Ectopic P granules protein 5 homolog / Homo sapiens    Q9HCE0
• Endoplasmic reticulum aminopeptidase 2 / Homo sapiens    Q6P179
• Endothelin-converting enzyme 1 / Homo sapiens    P42892
• Ephrin-B2 / Homo sapiens    P52799
• Epidermal growth factor receptor / Homo sapiens    P00533
• Epithelial cell adhesion molecule / Homo sapiens    P16422
• Erythropoietin / Homo sapiens    P01588
• Extracellular matrix protein 1 / Homo sapiens    Q16610
• Extracellular serine/threonine protein kinase FAM20C / Homo sapiens    Q8IXL6
• Fibrillin-1 / Homo sapiens    P35555
• Fibroleukin / Homo sapiens    Q14314
• Fibromodulin / Homo sapiens    Q06828
• Fibronectin / Homo sapiens    P02751
• Fibulin-1 / Homo sapiens    P23142
• G-protein coupled receptor 126 / Homo sapiens    Q86SQ4
• Galectin-3-binding protein / Homo sapiens    Q08380
• Gamma-glutamyltranspeptidase 1 / Homo sapiens    P19440
• Gliomedin [Cleaved into: Gliomedin shedded ectodomain] / Homo sapiens    Q6ZMI3
• Glyceraldehyde-3-phosphate dehydrogenase / Homo sapiens    P04406
• Glycocalicin / Homo sapiens    P07359
• Haptoglobin / Homo sapiens    P00738
• Hemopexin / Homo sapiens    P02790
• Heparin cofactor 2 / Homo sapiens    P05546
• Hepatocyte growth factor / Homo sapiens    P14210
• Hepatocyte growth factor activator / Homo sapiens    Q04756
• Hepatocyte growth factor receptor / Homo sapiens    P08581
• HLA class II histocompatibility antigen, DRB1-1 beta chain / Homo sapiens    P04229
• HLA class II histocompatibility antigen, DRB1-10 beta chain / Homo sapiens    Q30167
• HLA class II histocompatibility antigen, DRB1-9 beta chain / Homo sapiens    Q9TQE0
• Homeobox protein Hox-B3 / Homo sapiens    P14651
• Hypoxia up-regulated protein 1 / Homo sapiens    Q9Y4L1
• Immunoglobulin epsilon chain c region / Homo sapiens    P01854
• Immunoglobulin gamma / Homo sapiens    P01859    P01861    P01857    P01860
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens    P01854
• Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens    P01854
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Immunoglobulin superfamily containing leucine-rich repeat protein / Homo sapiens    O14498
• Inactive gamma-glutamyltranspeptidase 2 / Homo sapiens    P36268
• Inactive tyrosine-protein kinase 7 / Homo sapiens    Q13308
• Inhibin beta E chain / Homo sapiens    P58166
• Integrin alpha-2 / Homo sapiens    P17301
• Integrin alpha-5 / Homo sapiens    P08648
• Integrin alpha-5/beta-1 / Homo sapiens    P05556    P08648
• Integrin alpha-L / Homo sapiens    P20701
• Integrin beta-1 / Homo sapiens    P05556
• Integrin beta-2 / Homo sapiens    P05107
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Intercellular adhesion molecule 2 / Homo sapiens    P13598
• Interleukin-1 receptor type 2 / Homo sapiens    P27930
• Junction plakoglobin / Homo sapiens    P14923
• Keratin, type I cytoskeletal 9 / Homo sapiens    P35527
• Kininogen-1 / Homo sapiens    P01042
• Lactotransferrin / Homo sapiens    P02788
• Laminin subunit alpha-2 / Homo sapiens    P24043
• Laminin subunit alpha-4 / Homo sapiens    Q16363
• Laminin subunit gamma-1 / Homo sapiens    P11047
• Leptin receptor / Homo sapiens    P48357
• Leucine-rich alpha-2-glycoprotein / Homo sapiens    P02750
• Leucyl-cystinyl aminopeptidase / Homo sapiens    Q9UIQ6
• Leukocyte-associated immunoglobulin-like receptor 1 / Homo sapiens    Q6GTX8
• Lipoprotein lipase / Homo sapiens    P06858
• Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens    P08637
• Low-density lipoprotein receptor / Homo sapiens    P01130
• Lumican / Homo sapiens    P51884
• Lysosome membrane protein 2 / Homo sapiens    Q14108
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Macrophage colony-stimulating factor 1 receptor / Homo sapiens    P07333
• Maltase-glucoamylase, intestinal / Homo sapiens    O43451
• Mammaglobin-A / Homo sapiens    Q13296
• Metalloproteinase inhibitor 1 / Homo sapiens    P01033
• Microfibril-associated glycoprotein 4 / Homo sapiens    P55083
• Mimecan / Homo sapiens    P20774
• Multimerin-1 / Homo sapiens    Q13201
• Myeloperoxidase / Homo sapiens    P05164
• Neural cell adhesion molecule 2 / Homo sapiens    O15394
• Neuron navigator 2 / Homo sapiens    Q8IVL1
• Neuronal cell adhesion molecule / Homo sapiens    Q92823
• Neuroplastin / Homo sapiens    Q9Y639
• Olfactomedin-4 / Homo sapiens    Q6UX06
• Pantetheinase / Homo sapiens    O95497
• Periostin / Homo sapiens    Q15063
• Peroxidasin homolog / Homo sapiens    Q92626
• Phosphatidylinositol-glycan-specific phospholipase D / Homo sapiens    P80108
• Phosphoinositide-3-kinase-interacting protein 1 / Homo sapiens    Q96FE7
• Phospholipase D4 / Homo sapiens    Q96BZ4
• Phospholipid transfer protein / Homo sapiens    P55058
• Plasma protease c1 inhibitor / Homo sapiens    P05155
• Platelet endothelial cell adhesion molecule / Homo sapiens    P16284
• Plexin-B2 / Homo sapiens    O15031
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Prenylcysteine oxidase 1 / Homo sapiens    Q9UHG3
• Prolactin-inducible protein / Homo sapiens    P12273
• Prolargin / Homo sapiens    P51888
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens    Q07954
• Prolyl endopeptidase FAP / Homo sapiens    Q12884
• Prosaposin / Homo sapiens    P07602
• Prostaglandin F2 receptor negative regulator / Homo sapiens    Q9P2B2
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens    P07288
• Prothrombin / Homo sapiens    P00734
• Putative gamma-glutamyltranspeptidase 3 / Homo sapiens    A6NGU5
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens    P08575
• Receptor-type tyrosine-protein phosphatase eta / Homo sapiens    Q12913
• Receptor-type tyrosine-protein phosphatase F / Homo sapiens    P10586
• Receptor-type tyrosine-protein phosphatase gamma / Homo sapiens    P23470
• Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens    Q15262
• SCAN domain-containing protein 3 / Homo sapiens    Q6R2W3
• Scavenger receptor cysteine-rich type 1 protein M130 / Homo sapiens    Q86VB7
• Semaphorin-6A / Homo sapiens    Q9H2E6
• Serotransferrin / Homo sapiens    P02787
• Serum paraoxonase/arylesterase 1 / Homo sapiens    P27169
• Sodium/potassium-transporting ATPase subunit beta-1 / Homo sapiens    P05026
• Sodium/potassium-transporting ATPase subunit beta-3 / Homo sapiens    P54709
• Sortilin / Homo sapiens    Q99523
• Sparc / Homo sapiens    P09486
• Stabilin-1 / Homo sapiens    Q9NY15
• Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 / Homo sapiens    Q4LDE5
• Target of Nesh-SH3 / Homo sapiens    Q7Z7G0
• Tenascin / Homo sapiens    P24821
• Tenascin-N / Homo sapiens    Q9UQP3
• Tenascin-X / Homo sapiens    P22105
• TGF-beta receptor type-2 / Homo sapiens    P37173
• Thioredoxin domain-containing protein 15 / Homo sapiens    Q96J42
• Thrombopoietin / Homo sapiens    P40225
• Thrombospondin-1 / Homo sapiens    P07996
• Thrombospondin-2 / Homo sapiens    P35442
• Tissue-type plasminogen activator / Homo sapiens    P00750
• Transcobalamin-1 / Homo sapiens    P20061
• Transferrin receptor protein 1 / Homo sapiens    P02786
• Trophoblast glycoprotein / Homo sapiens    Q13641
• Tumor necrosis factor receptor superfamily member 17 / Homo sapiens    Q02223
• Tyrosine-protein kinase Mer / Homo sapiens    Q12866
• Tyrosine-protein kinase receptor UFO / Homo sapiens    P30530
• Uromodulin / Homo sapiens    P07911
• Vitronectin / Homo sapiens    P04004
• Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens    P54289
• Von willebrand factor / Homo sapiens    P04275
• WAP four-disulfide core domain protein 2 / Homo sapiens    Q14508
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• Salivary plasminogen activator alpha 1 / Desmodus rotundus    P98119
• Fetal antigen 1 / Mus musculus    Q09163
• Neuroligin 1 / Rattus norvegicus    Q62765
• Thyroglobulin / Sus scrofa    
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Human betacoronavirus 2c EMC/2012    K0BRG7
• Envelope glycoprotein / Friend murine leukemia virus    P03395
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Amniotic Fluid (UBERON_0000173)  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)   Mature NK T cell (CL_0000814)  
• Blood Serum (UBERON_0001977)  
• Bone Marrow (UBERON_0002371)  
• Colon (UBERON_0001155)  
• Kidney (UBERON_0002113)   BHK-21 (CVCL_1914)  
• Kidney (UBERON_0002113)   BHK570 (CVCL_6370)   Fibroblast (CL_0000057)  
• Kidney (UBERON_0002113)   HEK293 (CVCL_0045)  
• Kidney (UBERON_0002113)   HEK293-EBNA (CVCL_6974)  
• Liver (UBERON_0002107)  
• Mammary Gland (UBERON_0001911)   C127 (CVCL_6550)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• neocortex (UBERON:0001950)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)   CHO-DG44 (CVCL_7180)  
• Ovary (UBERON_0000992)  
• Placenta (UBERON_0001987)  
• Prefrontal Cortex (UBERON:0000451)  
• Seminal Fluid (UBERON_0006530)  
• Thyroid (UBERON_0002046)  
• Umbilical Vein (UBERON_0002066)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Urine (UBERON_0001088)  
• Eveline (CVCL_A1LI)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• HEK293SF-3F6 (CVCL_4V95)  
• HEK293T (CVCL_0063)  
• LS174T (CVCL_1384)  
• NCI-H929 (CVCL_1600)  
• Adipocytes (CL_0000136)  
• Adipose-derived stem cells (ADSCs) (CL_0000136)  
• Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)  
• Platelet (CL_0000233)   Plasma Membrane (GO_0005886)  

Reported structure

• N-Linked / Complex / Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Fuc + 2 x NeuAc(a2-?)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-3) + NeuAc(a2-6)"
• N-Linked / Complex / Structure 867
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x NeuAc(a2-3)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x NeuAc(a2-3)"
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-3)"
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-?)"
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-6)"
• N-Linked / Complex / Structure 1712
• N-Linked / Complex / Structure 1814
• N-Linked / Complex / Structure 2121
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ 2 x NeuAc(a2-6)"
• N-Linked / Complex / Hex(?1-?)HexNAc(?1-?)Man(a1-?)[Hex(?1-?)HexNAc(?1-?)[Hex(?1-?)HexNAc(?1-?)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ 2 x NeuAc"
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-3)"
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)[Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-3)"
• N-Linked / Complex / Structure 2575
• N-Linked / Complex / NeuAc(a2-?)Gal(b1-?)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-?)Gal(b1-?)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc+"+ Hex + HexNAc"
• N-Linked / Complex / Structure 9324
• N-Linked / Complex / Structure 9451
• N-Linked / Complex / Structure 9840
• N-Linked / Complex / Structure 9851
• N-Linked / Complex / Structure 10040
• N-Linked / Complex / Structure 10232
• N-Linked / Complex / Structure 10595
• N-Linked / Complex / Structure 10690
• N-Linked / Complex / Structure 10752
• N-Linked / Complex / Structure 10888
• N-Linked / Complex / Structure 10897
• N-Linked / Complex / Structure 10913
• N-Linked / Complex / Structure 10973
• N-Linked / Complex / Structure 11115
• N-Linked / Complex / Structure 11140
• N-Linked / Complex / Structure 11156
• N-Linked / Complex / Structure 11169
• N-Linked / Complex / Structure 11207
• N-Linked / Complex / Structure 11234
• N-Linked / Complex / Structure 11740
• N-Linked / Complex / Structure 11836
• N-Linked / Complex / Structure 11852

Composition

• Hex:6 HexNAc:5 dHex:1 NeuAc:2 (avg mass : 2735.5035 )

Disease

• Cancer, breast (DOID:1612)
• Carcinoma (DOID:305)
• Carcinoma, Hepatocellular (DOID:684)
• Colon adenocarcinoma (DOID:234)
• Control/Healthy
• COVID-19 (DOID:0080600)
• Esophageal cancer (DOID:5041)
• Familial hepatic adenoma (DOID:111366)
• Gastritis (DOID:4029)
• Hyperimmune condition
• IgE myeloma (DOID:9538)
• Maturity-onset diabetes of the young type 3 (DOID:0111102)
• Middle East respiratory syndrome (DOID:0080642)
• Mixed phenotype acute leukemia (DOID:9953)
• Multiple myeloma (DOID:9538)
• Prostate cancer (DOID:10283)
• Prostate Disease (DOID:47)

Reference

• Differential N- and O-glycosylation signatures of HIV-1 Gag virus-like particles and coproduced extracellular vesicles (2022 - Lavado-García J, Zhang T, Cervera L, Gòdia F, Wuhrer M) / Status : Reviewed
• Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
• Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
• Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
• Aberrant sialylation in a patient with a HNF1α variant and liver adenomatosis (2021 - Luisa Sturiale, Marie-Cécile Nassogne, Angelo Palmigiano, Angela Messina, Immacolata Speciale, Rosangela Artuso, Gaetano Bertino, Nicole Revencu, Xavier Stephénne, Cristina De Castro, Gert Matthijs, Rita Barone, Jaak Jaeken, Domenico Garozzo) / Status : Reviewed
• Profiling the proteoforms of urinary prostate-specific antigen by capillary electrophoresis – mass spectrometry (2021 - Alan B. Moran, Elena Domínguez-Vega, Jan Nouta, Tamas Pongracz, Theo M. de Reijke, Manfred Wuhrer, Guinevere S.M. Lageveen-Kammeijer) / Status : Reviewed
• Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
• Post-natal developmental changes in the composition of the rat neocortical N-glycome (2021 - Klarić TS, Salopek M, Micek V, Gornik Kljaić O, Lauc G) / Status : Reviewed
• Direct Comparison of N-Glycans and Their Isomers Derived from Spike Glycoprotein 1 of MERS-CoV, SARS-CoV-1, and SARS-CoV-2 (2021 - Cho BG, Gautam S, Peng W, Huang Y, Goli M, Mechref Y) / Status : Reviewed
• Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
• Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
• Spatial and temporal diversity of glycome expression in mammalian brain (2020 - Lee J, Ha S, Kim M, Kim SW, Yun J, Ozcan S, Hwang H, Ji IJ, Yin D, Webster MJ, Shannon Weickert C, Kim JH, Yoo JS, Grimm R, Bahn S, Shin HS, An HJ) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
• Cysteine Aminoethylation Enables the Site-Specific Glycosylation Analysis of Recombinant Human Erythropoietin using Trypsin (2020 - Steffen Lippold, Alexander Büttner, Matthew S.F. Choo, Michaela Hook, Coen J. de Jong, Terry Nguyen-Khuong, Markus Haberger, Dietmar Reusch, Manfred Wuhrer, Noortje de Haan) / Status : Reviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
• Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
• A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
• Site-specific N-glycosylation analysis of human factor XI: Identification of a noncanonical NXC glycosite (2014 - Faid V, Denguir N, Chapuis V, Bihoreau N, Chevreux G) / Status : Reviewed
• Computational framework for identification of intact glycopeptides in complex samples (2014 - Mayampurath A, Yu CY, Song E, Balan J, Mechref Y, Tang H.) / Status : Reviewed
• In-depth analysis of site-specific N-glycosylation in vitronectin from human plasma by tandem mass spectrometry with immunoprecipitation (2014 - Hwang H, Lee JY, Lee HK, Park GW, Jeong HK, Moon MH, Kim JY, Yoo JS.) / Status : Reviewed
• Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
• Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
• Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
• Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
• Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
• B-cell maturation antigen is modified by a single N-glycan chain that modulates ligand binding and surface retention. (2013 - Huang HW, Chen CH, Lin CH, Wong CH, Lin KI) / Status : Reviewed
• Quantitative analysis of site-specific N-glycans on sera haptoglobin β chain in liver diseases. (2013 - Zhang S, Jiang K, Sun C, Lu H, Liu Y.) / Status : Reviewed
• Exploring site-specific N-glycosylation microheterogeneity of haptoglobin using glycopeptide CID tandem mass spectra and glycan database search (2013 - Chandler KB1, Pompach P, Goldman R, Edwards N.) / Status : Reviewed
• Determination of site-specific glycan heterogeneity on glycoproteins (2012 - Kolarich D1, Jensen PH, Altmann F, Packer NH.) / Status : Reviewed
• Structural characterization of recombinant soluble rat neuroligin 1: mapping of secondary structure and glycosylation by mass spectrometry. (2004 - Hoffman RC, Jennings LL, Tsigelny I, Comoletti D, Flynn RE, Sudhof TC, Taylor P) / Status : Reviewed
• Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
• Structural determination of N-linked carbohydrates by matrix-assisted laser desorption/ionization-mass spectrometry following enzymatic release within sodium dodecyl sulfate-polyacrylamide electrophoresis gels: application to species-specific glycosylation of alpha1-acid glycoprotein. (1998 - Kuster B, Hunter A, Wheeler S, Dwek R, Harvey D) / Status : Reviewed
• Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
• Glycosylation analysis and protein structure determination of murine fetal antigen 1 (mFA1)--the circulating gene product of the delta-like protein (dlk), preadipocyte factor 1 (Pref-1) and stromal-cell-derived protein 1 (SCP-1) cDNAs. (1997 - Krogh T, Bachmann E, Teisner B, Skjdt K, Hjrup P) / Status : Reviewed
• Elucidation of N-linked oligosaccharide structures of recombinant human factor VIII using fluorophore-assisted carbohydrate electrophoresis. (1996 - Kumar H, Hague C, Haley T, Starr C, Besman M, Lundblad R, Baker D) / Status : Reviewed
• Peptide, disulfide, and glycosylation mapping of recombinant human thrombopoietin from ser1 to Arg246. (1996 - Hoffman RC, Andersen H, Walker K, Krakover JD, Patel S, Stamm MR, Osborn SG) / Status : Reviewed
• Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
• Structural analysis of the sialylated N- and O-linked carbohydrate chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. Sialylation patterns and branch location of dimeric N-acetyllactosamine units. (1995 - Hokke C, Bergwerff A, Van Dedem G, Kamerling J, Vliegenthart J) / Status : Reviewed
• Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
• Structures of sialylated oligosaccharides of human erythropoietin expressed in recombinant BHK-21 cells. (1993 - Nimtz M, Martin W, Wray V, Klppel K, Augustin J, Conradt H) / Status : Reviewed
• Primary structure of N-linked carbohydrate chains of a human chimeric plasminogen activator K2tu-PA expressed in Chinese hamster ovary cells. (1993 - Bergwerff A, van Oostrum J, Asselbergs F, Brgi R, Hokke C, Kamerling J, Vliegenthart J) / Status : Reviewed
• Structural study of the N-linked oligosaccharides of hepatocyte growth factor by two-dimensional sugar mapping. (1993 - Hara H, Nakae Y, Sogabe T, Ihara I, Ueno S, Sakai H, Inoue H, Shimizu S, Nakamura T, Shimizu N) / Status : Reviewed
• The Asn-linked carbohydrate chains of human Tamm-Horsfall glycoprotein of one male. Novel sulfated and novel N-acetylgalactosamine-containing N-linked carbohydrate chains. (1992 - Hard K, Van Zadelhoff G, Moonen P, Kamerling J, Vliegenthart F) / Status : Reviewed
• Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed
• Carbohydrate structures of a human tissue plasminogen activator variant expressed in recombinant Chinese hamster ovary cells. (1990 - Nimtz M, Noll G, Pques E, Conradt H) / Status : Reviewed
• Analysis of N- and O-glycosidically bound sialooligosaccharides in glycoproteins by high-performance liquid chromatography with pulsed amperometric detection. (1990 - Honda S, Suzuki S, Zaiki S, Kakehi K) / Status : Reviewed
• Carbohydrate structure of recombinant human uterine tissue plasminogen activator expressed in mouse epithelial cells. (1989 - Pfeiffer G, Schmidt M, Strube K, Geyer R) / Status : Reviewed
• Identification of a tetrasialylated monofucosylated tetraantennary N-linked carbohydrate chain in human platelet glycocalicin. (1988 - Korrel S, Clemetson K, van Halbeek H, Kamerling J, Sixma J, Vliegenthart J) / Status : Reviewed
• The structures and microheterogeneity of the carbohydrate chains of human plasma ceruloplasmin. A study employing 500-MHz 1H-NMR spectroscopy. (1982 - Endo M, Suzuki K, Schmid K, Fournet B, Karamanos Y, Montreuil J, Dorland L, van Halbeek H, Vliegenthart J) / Status : Reviewed

Reported glycosite

• 4F2 cell-surface antigen heavy chain / Homo sapiens
  •        Asn-365
• ADAM DEC1 / Homo sapiens
  •        Asn-184
  •        Asn-237
• Adenosine deaminase 2 / Homo sapiens
  •        Asn-127
• Adhesion G protein-coupled receptor F5 / Homo sapiens
  •        Asn-328
  •        Asn-718
• Adhesion G protein-coupled receptor L4 / Homo sapiens
  •        Asn-249
• Adhesion G-protein coupled receptor D1 / Homo sapiens
  •        Asn-394
• Adipocyte enhancer-binding protein 1 / Homo sapiens
  •        Asn-528
• Adipocyte plasma membrane-associated protein / Homo sapiens
  •        Asn-160
• Alkaline phosphatase, tissue-nonspecific isozyme / Homo sapiens
  •        Asn-430
• Alpha-1-acid glycoprotein 1 / Homo sapiens
  •        Undefined site
  •        Asn-33
  •        Asn-56
  •        Asn-72
  •        Asn-93
• Alpha-1-acid glycoprotein 2 / Homo sapiens
  •        Undefined site
  •        Asn-33
  •        Asn-72
  •        Asn-88
  •        Asn-93
• Alpha-1-antichymotrypsin / Homo sapiens
  •        Asn-106
  •        Asn-127
  •        Asn-271
• Alpha-1-antitrypsin / Homo sapiens
  •        Undefined site
  •        Asn-107
  •        Asn-271
• Alpha-2-HS-glycoprotein / Homo sapiens
  •        Asn-156
  •        Asn-176
• Alpha-2-macroglobulin / Homo sapiens
  •        Asn-1424
• Alpha-2-macroglobulin receptor-associated protein / Homo sapiens
  •        Asn-268
• Alpha-n-acetylgalactosaminidase / Homo sapiens
  •        Undefined site
• Alpha-S1-casein / Homo sapiens
  •        Asn-69
• Angiopoietin-1 receptor / Homo sapiens
  •        Asn-691
• Angiotensin-converting enzyme / Homo sapiens
  •        Asn-146
  •        Asn-695
  •        Asn-714
• Angiotensin-converting enzyme 2 / Homo sapiens
  •        Undefined site
• Apolipoprotein (a) / Homo sapiens
  •        Asn-183
  •        Asn-4057
• Apolipoprotein B-100 / Homo sapiens
  •        Asn-3411
  •        Asn-4351
• Apolipoprotein D / Homo sapiens
  •        Asn-65
  •        Asn-98
• Apolipoprotein F / Homo sapiens
  •        Asn-118
  •        Asn-139
• Asialoglycoprotein receptor 2 / Homo sapiens
  •        Asn-170
• Asporin / Homo sapiens
  •        Asn-282
• Attractin / Homo sapiens
  •        Asn-1198
• Beta-2-glycoprotein 1 / Homo sapiens
  •        Asn-162
  •        Asn-253
• Beta-Ala-His dipeptidase / Homo sapiens
  •        Asn-382
• Biglycan / Homo sapiens
  •        Asn-270
  •        Asn-311
• Butyrophilin subfamily 1 member A1 / Homo sapiens
  •        Asn-215
• Cadherin-2 / Homo sapiens
  •        Asn-402
• Cadherin-5 / Homo sapiens
  •        Asn-535
• Carbonic anhydrase 6 / Homo sapiens
  •        Asn-256
• Carboxypeptidase b2 / Homo sapiens
  •        Asn-73
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
  •        Undefined site
• Catalase / Homo sapiens
  •        Asn-481
• Cation-independent mannose-6-phosphate receptor / Homo sapiens
  •        Asn-2348
• CD109 antigen / Homo sapiens
  •        Asn-247
  •        Asn-419
  •        Asn-513
• CD166 antigen / Homo sapiens
  •        Asn-91
  •        Asn-306
  •        Asn-361
  •        Asn-480
• CD276 antigen / Homo sapiens
  •        Asn-215
• CD44 antigen / Homo sapiens
  •        Asn-57
• CD59 glycoprotein / Homo sapiens
  •        Asn-43
• CD63 antigen / Homo sapiens
  •        Asn-130
• Cell adhesion molecule 1 / Homo sapiens
  •        Asn-113
• Ceruloplasmin / Homo sapiens
  •        Undefined site
  •        Asn-138
  •        Asn-397
  •        Asn-762
• Chimeric plasminogen activator K2-tuPA / Homo sapiens
  •        Asn-219
• Cholinesterase / Homo sapiens
  •        Asn-509
• Clusterin / Homo sapiens
  •        Asn-86
  •        Asn-103
  •        Asn-354
  •        Asn-374
• Coagulation factor VIII / Homo sapiens
  •        Undefined site
• Coagulation factor XI / Homo sapiens
  •        Asn-90
  •        Asn-450
  •        Asn-491
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-2679
• Collectin-12 / Homo sapiens
  •        Asn-386
• Complement c1r subcomponent / Homo sapiens
  •        Asn-125
• Complement C2 / Homo sapiens
  •        Asn-467
  •        Asn-651
• Complement component c6 / Homo sapiens
  •        Asn-324
• Complement factor h / Homo sapiens
  •        Asn-882
  •        Asn-911
• Complement factor i / Homo sapiens
  •        Asn-177
• Contactin-1 / Homo sapiens
  •        Asn-494
• Contactin-3 / Homo sapiens
  •        Asn-895
• Contactin-4 / Homo sapiens
  •        Asn-65
  •        Asn-764
  •        Asn-858
• Corticotropin-releasing factor-binding protein / Homo sapiens
  •        Asn-204
• Decorin / Homo sapiens
  •        Asn-262
  •        Asn-303
• Desmocollin-2 / Homo sapiens
  •        Asn-34
  •        Asn-392
• Dipeptidyl peptidase 1 / Homo sapiens
  •        Asn-53
  •        Asn-276
• Dipeptidyl peptidase 4 / Homo sapiens
  •        Asn-520
• Ecto-ADP-ribosyltransferase 4 / Homo sapiens
  •        Asn-178
  •        Asn-274
• Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
  •        Asn-294
  •        Asn-378
• Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 / Homo sapiens
  •        Asn-285
• Ectopic P granules protein 5 homolog / Homo sapiens
  •        Asn-137
• Endoplasmic reticulum aminopeptidase 2 / Homo sapiens
  •        Asn-294
• Endothelin-converting enzyme 1 / Homo sapiens
  •        Asn-632
• Ephrin-B2 / Homo sapiens
  •        Asn-36
  •        Asn-282
• Epidermal growth factor receptor / Homo sapiens
  •        Asn-603
  •        Asn-816
• Epithelial cell adhesion molecule / Homo sapiens
  •        Asn-74
• Erythropoietin / Homo sapiens
  •        Undefined site
  •        Asn-51
  •        Asn-65
  •        Asn-110
• Extracellular matrix protein 1 / Homo sapiens
  •        Asn-354
  •        Asn-444
• Extracellular serine/threonine protein kinase FAM20C / Homo sapiens
  •        Asn-335
• Fibrillin-1 / Homo sapiens
  •        Asn-2767
• Fibroleukin / Homo sapiens
  •        Asn-336
• Fibromodulin / Homo sapiens
  •        Asn-166
• Fibronectin / Homo sapiens
  •        Asn-528
• Fibulin-1 / Homo sapiens
  •        Asn-98
• G-protein coupled receptor 126 / Homo sapiens
  •        Asn-314
• Galectin-3-binding protein / Homo sapiens
  •        Asn-398
• Gamma-glutamyltranspeptidase 1 / Homo sapiens
  •        Asn-297
  •        Asn-511
• Gliomedin [Cleaved into: Gliomedin shedded ectodomain] / Homo sapiens
  •        Asn-130
• Glyceraldehyde-3-phosphate dehydrogenase / Homo sapiens
  •        Asn-149
• Glycocalicin / Homo sapiens
  •        Undefined site
• Haptoglobin / Homo sapiens
  •        Asn-184
  •        Asn-207
  •        Asn-241
• Hemopexin / Homo sapiens
  •        Asn-187
  •        Asn-453
• Heparin cofactor 2 / Homo sapiens
  •        Asn-49
• Hepatocyte growth factor / Homo sapiens
  •        Asn-294
  •        Asn-402
  •        Asn-566
  •        Asn-653
• Hepatocyte growth factor activator / Homo sapiens
  •        Asn-290
• Hepatocyte growth factor receptor / Homo sapiens
  •        Asn-1171
• HLA class II histocompatibility antigen, DRB1-1 beta chain / Homo sapiens
  •        Asn-48
• HLA class II histocompatibility antigen, DRB1-10 beta chain / Homo sapiens
  •        Asn-48
• HLA class II histocompatibility antigen, DRB1-9 beta chain / Homo sapiens
  •        Asn-48
• Homeobox protein Hox-B3 / Homo sapiens
  •        Asn-226
• Hypoxia up-regulated protein 1 / Homo sapiens
  •        Asn-515
  •        Asn-830
• Immunoglobulin epsilon chain c region / Homo sapiens
  •        Asn-21
  •        Asn-49
  •        Asn-99
  •        Asn-146
  •        Asn-252
• Immunoglobulin gamma / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Asn-340
• Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Undefined site
• Immunoglobulin superfamily containing leucine-rich repeat protein / Homo sapiens
  •        Asn-120
• Inactive gamma-glutamyltranspeptidase 2 / Homo sapiens
  •        Asn-297
• Inactive tyrosine-protein kinase 7 / Homo sapiens
  •        Asn-116
  •        Asn-567
• Inhibin beta E chain / Homo sapiens
  •        Asn-198
• Integrin alpha-2 / Homo sapiens
  •        Asn-1057
• Integrin alpha-5 / Homo sapiens
  •        Asn-297
  •        Asn-518
• Integrin alpha-5/beta-1 / Homo sapiens
  •        Undefined site
• Integrin alpha-L / Homo sapiens
  •        Asn-89
• Integrin beta-1 / Homo sapiens
  •        Asn-669
• Integrin beta-2 / Homo sapiens
  •        Asn-50
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-517
  •        Asn-577
• Intercellular adhesion molecule 2 / Homo sapiens
  •        Asn-176
• Interleukin-1 receptor type 2 / Homo sapiens
  •        Asn-66
• Junction plakoglobin / Homo sapiens
  •        Asn-378
• Keratin, type I cytoskeletal 9 / Homo sapiens
  •        Asn-266
• Kininogen-1 / Homo sapiens
  •        Asn-169
  •        Asn-205
  •        Asn-294
• Lactotransferrin / Homo sapiens
  •        Asn-156
  •        Asn-497
  •        Asn-642
• Laminin subunit alpha-2 / Homo sapiens
  •        Asn-89
  •        Asn-1810
  •        Asn-2478
• Laminin subunit alpha-4 / Homo sapiens
  •        Asn-810
• Laminin subunit gamma-1 / Homo sapiens
  •        Asn-1223
• Leptin receptor / Homo sapiens
  •        Asn-98
  •        Asn-206
  •        Asn-276
  •        Asn-659
• Leucine-rich alpha-2-glycoprotein / Homo sapiens
  •        Asn-186
• Leucyl-cystinyl aminopeptidase / Homo sapiens
  •        Asn-834
  •        Asn-850
• Leukocyte-associated immunoglobulin-like receptor 1 / Homo sapiens
  •        Asn-69
• Lipoprotein lipase / Homo sapiens
  •        Asn-70
• Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
  •        Asn-180
  •        Asn-187
• Low-density lipoprotein receptor / Homo sapiens
  •        Asn-272
• Lumican / Homo sapiens
  •        Asn-88
  •        Asn-127
  •        Asn-160
  •        Asn-252
• Lysosome membrane protein 2 / Homo sapiens
  •        Asn-412
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-84
  •        Asn-249
  •        Asn-261
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-58
  •        Asn-101
  •        Asn-275
• Macrophage colony-stimulating factor 1 receptor / Homo sapiens
  •        Asn-153
• Maltase-glucoamylase, intestinal / Homo sapiens
  •        Asn-707
• Mammaglobin-A / Homo sapiens
  •        Asn-53
• Metalloproteinase inhibitor 1 / Homo sapiens
  •        Asn-53
• Microfibril-associated glycoprotein 4 / Homo sapiens
  •        Asn-137
• Mimecan / Homo sapiens
  •        Asn-214
• Multimerin-1 / Homo sapiens
  •        Asn-209
  •        Asn-431
  •        Asn-576
  •        Asn-816
• Myeloperoxidase / Homo sapiens
  •        Asn-323
  •        Asn-355
• Neural cell adhesion molecule 2 / Homo sapiens
  •        Asn-562
• Neuron navigator 2 / Homo sapiens
  •        Asn-137
• Neuronal cell adhesion molecule / Homo sapiens
  •        Asn-83
  •        Asn-223
  •        Asn-276
• Neuroplastin / Homo sapiens
  •        Asn-197
• Olfactomedin-4 / Homo sapiens
  •        Asn-253
• Pantetheinase / Homo sapiens
  •        Asn-130
• Periostin / Homo sapiens
  •        Asn-599
• Peroxidasin homolog / Homo sapiens
  •        Asn-964
  •        Asn-1178
• Phosphatidylinositol-glycan-specific phospholipase D / Homo sapiens
  •        Asn-321
• Phosphoinositide-3-kinase-interacting protein 1 / Homo sapiens
  •        Asn-66
• Phospholipase D4 / Homo sapiens
  •        Asn-417
• Phospholipid transfer protein / Homo sapiens
  •        Asn-64
• Plasma protease c1 inhibitor / Homo sapiens
  •        Asn-25
  •        Asn-238
  •        Asn-253
  •        Asn-352
• Platelet endothelial cell adhesion molecule / Homo sapiens
  •        Asn-84
• Plexin-B2 / Homo sapiens
  •        Asn-127
  •        Asn-1099
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-90
  •        Asn-421
  •        Asn-469
  •        Asn-499
• Prenylcysteine oxidase 1 / Homo sapiens
  •        Asn-288
• Prolactin-inducible protein / Homo sapiens
  •        Asn-105
• Prolargin / Homo sapiens
  •        Asn-327
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
  •        Asn-136
  •        Asn-729
  •        Asn-1511
  •        Asn-1825
  •        Asn-2942
  •        Asn-3048
• Prolyl endopeptidase FAP / Homo sapiens
  •        Asn-49
• Prosaposin / Homo sapiens
  •        Asn-101
  •        Asn-215
  •        Asn-332
• Prostaglandin F2 receptor negative regulator / Homo sapiens
  •        Asn-286
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-78
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
  •        Asn-69
• Prothrombin / Homo sapiens
  •        Asn-416
• Putative gamma-glutamyltranspeptidase 3 / Homo sapiens
  •        Asn-297
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens
  •        Asn-490
• Receptor-type tyrosine-protein phosphatase eta / Homo sapiens
  •        Asn-342
• Receptor-type tyrosine-protein phosphatase F / Homo sapiens
  •        Asn-966
• Receptor-type tyrosine-protein phosphatase gamma / Homo sapiens
  •        Asn-444
  •        Asn-1207
• Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
  •        Asn-462
• SCAN domain-containing protein 3 / Homo sapiens
  •        Asn-490
• Scavenger receptor cysteine-rich type 1 protein M130 / Homo sapiens
  •        Asn-105
• Semaphorin-6A / Homo sapiens
  •        Asn-65
• Serotransferrin / Homo sapiens
  •        Undefined site
  •        Asn-432
  •        Asn-630
• Serum paraoxonase/arylesterase 1 / Homo sapiens
  •        Asn-324
• Sodium/potassium-transporting ATPase subunit beta-1 / Homo sapiens
  •        Asn-193
• Sodium/potassium-transporting ATPase subunit beta-3 / Homo sapiens
  •        Asn-124
• Sortilin / Homo sapiens
  •        Asn-98
• Sparc / Homo sapiens
  •        Asn-116
• Stabilin-1 / Homo sapiens
  •        Asn-816
• Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 / Homo sapiens
  •        Asn-2779
• Target of Nesh-SH3 / Homo sapiens
  •        Asn-313
  •        Asn-690
• Tenascin / Homo sapiens
  •        Asn-166
  •        Asn-1079
  •        Asn-1392
  •        Asn-1485
• Tenascin-N / Homo sapiens
  •        Asn-1052
• Tenascin-X / Homo sapiens
  •        Asn-3855
• TGF-beta receptor type-2 / Homo sapiens
  •        Asn-564
• Thioredoxin domain-containing protein 15 / Homo sapiens
  •        Asn-181
• Thrombopoietin / Homo sapiens
  •        Undefined site
• Thrombospondin-1 / Homo sapiens
  •        Asn-248
• Thrombospondin-2 / Homo sapiens
  •        Asn-330
• Tissue-type plasminogen activator / Homo sapiens
  •        Undefined site
• Transcobalamin-1 / Homo sapiens
  •        Asn-369
• Transferrin receptor protein 1 / Homo sapiens
  •        Asn-251
• Trophoblast glycoprotein / Homo sapiens
  •        Asn-275
• Tumor necrosis factor receptor superfamily member 17 / Homo sapiens
  •        Asn-42
• Tyrosine-protein kinase Mer / Homo sapiens
  •        Asn-170
• Tyrosine-protein kinase receptor UFO / Homo sapiens
  •        Asn-345
• Uromodulin / Homo sapiens
  •        Undefined site
  •        Asn-232
• Vitronectin / Homo sapiens
  •        Asn-86
  •        Asn-169
  •        Asn-242
• Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens
  •        Asn-888
• Von willebrand factor / Homo sapiens
  •        Asn-156
  •        Asn-2585
• WAP four-disulfide core domain protein 2 / Homo sapiens
  •        Asn-44
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-109
  •        Asn-128
• Salivary plasminogen activator alpha 1 / Desmodus rotundus
  •        Asn-398
• Fetal antigen 1 / Mus musculus
  •        Asn-100
• Neuroligin 1 / Rattus norvegicus
  •        Undefined site
• Thyroglobulin / Sus scrofa
  •        Undefined site
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Human betacoronavirus 2c EMC/2012
  •        Undefined site
• Envelope glycoprotein / Friend murine leukemia virus
  •        Asn-334 and/or Asn-341
  •        Asn-341 and/or Asn-334
  •        Asn-266
  •        Asn-302
  •        Asn-374
  •        Asn-410
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-61
  •        Asn-74
  •        Asn-149
  •        Asn-331
  •        Asn-657
  •        Asn-1098
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-165
  •        Asn-343
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Undefined site
  •        Asn-343

Mass spectrometry observed peptide

• NPNATSSSSQDPESLQDR (18aa)
  •    P05155    Asn-25     Plasma protease c1 inhibitor / Homo sapiens
• LVPVPITNATLDQITGK (17aa)
  •    P02763    Asn-33     Alpha-1-acid glycoprotein 1 / Homo sapiens
• LVPVPITNATLDR (13aa)
  •    P19652    Asn-33     Alpha-1-acid glycoprotein 2 / Homo sapiens
• NVTLHVPSK (9aa)
  •    Q02487    Asn-34     Desmocollin-2 / Homo sapiens
• SIVLEPIYWNSSNSK (15aa)
  •    P52799    Asn-36     Ephrin-B2 / Homo sapiens
• YCNASVTNSVK (11aa)
  •    Q02223    Asn-42     Tumor necrosis factor receptor superfamily member 17 / Homo sapiens
• TAVNCSSDFDACLITK (16aa)
  •    P13987    Asn-43     CD59 glycoprotein / Homo sapiens
• KTAVNCSSDFDACLITKA (18aa)
  •    P13987    Asn-43     CD59 glycoprotein / Homo sapiens
• TAVNCSSDFDACIITK (16aa)
  •    P13987    Asn-43     CD59 glycoprotein / Homo sapiens
• TGVCPELQADQNCTQECVSDSECADNLK (28aa)
  •    Q14508    Asn-44     WAP four-disulfide core domain protein 2 / Homo sapiens
• FECHFFNGTER (11aa)
  •    Q9TQE0    Asn-48     HLA class II histocompatibility antigen, DRB1-9 beta chain / Homo sapiens
  •    P04229    Asn-48     HLA class II histocompatibility antigen, DRB1-1 beta chain / Homo sapiens
  •    Q30167    Asn-48     HLA class II histocompatibility antigen, DRB1-10 beta chain / Homo sapiens
• NLSMPLLPADFHK (13aa)
  •    P05546    Asn-49     Heparin cofactor 2 / Homo sapiens
• DILNGTFSYK (10aa)
  •    Q12884    Asn-49     Prolyl endopeptidase FAP / Homo sapiens
• INFTGPGDPDSIR (13aa)
  •    P05107    Asn-50     Integrin beta-2 / Homo sapiens
• EAENITTGC (9aa)
  •    P01588    Asn-51     Erythropoietin / Homo sapiens
• DVNCSVMGPQEK (12aa)
  •    P53634    Asn-53     Dipeptidyl peptidase 1 / Homo sapiens
• ELLQEFIDDNATTNAIDELK (20aa)
  •    Q13296    Asn-53     Mammaglobin-A / Homo sapiens
• KWFYIASAFRNEEYNKS (17aa)
  •    P02763    Asn-56     Alpha-1-acid glycoprotein 1 / Homo sapiens
• AFNSTLPTMAQMEK (14aa)
  •    P16070    Asn-57     CD44 antigen / Homo sapiens
• YETTNK (6aa)
  •    P13473    Asn-58     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• FSNVTWF (7aa)
  •    P0DTC2    Asn-61     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EGHFYYNISEVK (12aa)
  •    P55058    Asn-64     Phospholipid transfer protein / Homo sapiens
• LNGTDVDTGMDFR (13aa)
  •    Q8IWV2    Asn-65     Contactin-4 / Homo sapiens
• LDIQMIMIMNGTLYIAAR (18aa)
  •    Q9H2E6    Asn-65     Semaphorin-6A / Homo sapiens
• SLNENITVPDTK (12aa)
  •    P01588    Asn-65     Erythropoietin / Homo sapiens
• CIQANYSIMENGK (13aa)
  •    P05090    Asn-65     Apolipoprotein D / Homo sapiens
• INLTWHK (7aa)
  •    P27930    Asn-66     Interleukin-1 receptor type 2 / Homo sapiens
• CLNWLDAQSGLASAPVSGAGNHSYCR (26aa)
  •    Q96FE7    Asn-66     Phosphoinositide-3-kinase-interacting protein 1 / Homo sapiens
• NKSVLLGR (8aa)
  •    P07288    Asn-69     Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
• STYNDTEDVSQASPSESEAR (20aa)
  •    Q6GTX8    Asn-69     Leukocyte-associated immunoglobulin-like receptor 1 / Homo sapiens
• NK (2aa)
  •    P07288    Asn-69     Prostate-specific antigen (psa-1) / Homo sapiens
• KDTRNESTQNCVVAEPEKM (19aa)
  •    P47710    Asn-69     Alpha-S1-casein / Homo sapiens
• RTPEDTAEDTCHLIPGVAESVATCHFNHSSKT (32aa)
  •    P06858    Asn-70     Lipoprotein lipase / Homo sapiens
• SVQEIQATFFYFTPNKTEDTIFLR (24aa)
  •    P19652    Asn-72     Alpha-1-acid glycoprotein 2 / Homo sapiens
  •    P02763    Asn-72     Alpha-1-acid glycoprotein 1 / Homo sapiens
• SVQEIQATFFYFTPNK (16aa)
  •    P19652    Asn-72     Alpha-1-acid glycoprotein 2 / Homo sapiens
  •    P02763    Asn-72     Alpha-1-acid glycoprotein 1 / Homo sapiens
• YFTPNKTEDTIFLR (14aa)
  •    P19652    Asn-72     Alpha-1-acid glycoprotein 2 / Homo sapiens
  •    P02763    Asn-72     Alpha-1-acid glycoprotein 1 / Homo sapiens
• KQVHFFVNASDVDNVK (16aa)
  •    Q96IY4    Asn-73     Carboxypeptidase b2 / Homo sapiens
• HAIHVSGTNGTKRF (14aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• AEMNGSK (7aa)
  •    P16422    Asn-74     Epithelial cell adhesion molecule / Homo sapiens
• SVVAPATDGGLNLTSTFLR (19aa)
  •    P41222    Asn-78     Prostaglandin-h2 d-isomerase / Homo sapiens
• NGTHFDIDK (9aa)
  •    Q92823    Asn-83     Neuronal cell adhesion molecule / Homo sapiens
• DDVLFYNISSMK (12aa)
  •    P16284    Asn-84     Platelet endothelial cell adhesion molecule / Homo sapiens
• SSCGKENTSDPSIVIAFGR (19aa)
  •    P11279    Asn-84     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• NNATVHEQVGGPSLTSDLQAQSK (23aa)
  •    P04004    Asn-86     Vitronectin / Homo sapiens
• KNNATVHEQVGGPSLTSDLQAQSKG (25aa)
  •    P04004    Asn-86     Vitronectin / Homo sapiens
• KKKEDALNETRE (12aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• KKKEDALNETRESETKL (17aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• KEDALNETRESETKL (15aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• KEDALNETRE (10aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• AFENVTDLQWLILDHNLLENSK (22aa)
  •    P51884    Asn-88     Lumican / Homo sapiens
• GSNYTSK (7aa)
  •    P20701    Asn-89     Integrin alpha-L / Homo sapiens
• ICNQNSSNPNQR (12aa)
  •    P24043    Asn-89     Laminin subunit alpha-2 / Homo sapiens
• RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
  •    P01833    Asn-90     Polymeric immunoglobulin receptor / Homo sapiens
• INISENYTISISNAR (15aa)
  •    Q13740    Asn-91     CD166 antigen / Homo sapiens
• QNQCFYNSSYLNVQR (15aa)
  •    P19652    Asn-88     Alpha-1-acid glycoprotein 2 / Homo sapiens
  •    P19652    Asn-93     Alpha-1-acid glycoprotein 2 / Homo sapiens
• QDQCIYNTTYLNVQR (15aa)
  •    P02763    Asn-93     Alpha-1-acid glycoprotein 1 / Homo sapiens
• QDQCIYNTTYINVQR (15aa)
  •    P02763    Asn-93     Alpha-1-acid glycoprotein 1 / Homo sapiens
• IANNTHQHVFDDIR (14aa)
  •    Q99523    Asn-98     Sortilin / Homo sapiens
• ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
  •    P05090    Asn-98     Apolipoprotein D / Homo sapiens
• NCSLCADNIEGK (12aa)
  •    P48357    Asn-98     Leptin receptor / Homo sapiens
• CATPHGDNASIEATFVK (17aa)
  •    P23142    Asn-98     Fibulin-1 / Homo sapiens
• ADGTVNQIEGEATPVNLTEPAK (22aa)
  •    P05090    Asn-98     Apolipoprotein D / Homo sapiens
• IAVQFGPGFSWIANFTK (17aa)
  •    P13473    Asn-101     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• TCDWIPKPNMSASCK (15aa)
  •    P07602    Asn-101     Prosaposin / Homo sapiens
• ELPGVCNETMMALWEECKPCLK (22aa)
  •    P10909    Asn-103     Clusterin / Homo sapiens
• ELPGVCNETMMALWEECK (18aa)
  •    P10909    Asn-103     Clusterin / Homo sapiens
• APGWANSSAGSGR (13aa)
  •    Q86VB7    Asn-105     Scavenger receptor cysteine-rich type 1 protein M130 / Homo sapiens
• TFYWDFYTNR (10aa)
  •    P12273    Asn-105     Prolactin-inducible protein / Homo sapiens
• FNITETSEAEIHQSFQHIIR (20aa)
  •    P01011    Asn-106     Alpha-1-antichymotrypsin / Homo sapiens
• ADTHDEIIEGINFNITEIPEAQIHEGFQEIIR (32aa)
  •    P01009    Asn-107     Alpha-1-antitrypsin / Homo sapiens
• ADTHDEILEGLNFNLTEIPEAQIHEGFQELLR (32aa)
  •    P01009    Asn-107     Alpha-1-antitrypsin / Homo sapiens
• DIVEYYNDSNGSHVLQGR (18aa)
  •    P25311    Asn-109     Zinc-alpha-2-glycoprotein / Homo sapiens
• GQALLVNSSQPWEPLQLHVDK (21aa)
  •    P01588    Asn-110     Erythropoietin / Homo sapiens
• VSLTNVSISDEGR (13aa)
  •    Q9BY67    Asn-113     Cell adhesion molecule 1 / Homo sapiens
• VCSNDNK (7aa)
  •    P09486    Asn-116     Sparc / Homo sapiens
• SANASFNIK (9aa)
  •    Q13308    Asn-116     Inactive tyrosine-protein kinase 7 / Homo sapiens
• QGGVNATQVLIQHLR (15aa)
  •    Q13790    Asn-118     Apolipoprotein F / Homo sapiens
• SLDLSHNLISDFAWSDLHNLSALQLLK (27aa)
  •    O14498    Asn-120     Immunoglobulin superfamily containing leucine-rich repeat protein / Homo sapiens
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NITVCPDGAIFEQK (14aa)
  •    P54709    Asn-124     Sodium/potassium-transporting ATPase subunit beta-3 / Homo sapiens
• MLLTFHTDFSNEENGTIMFYK (21aa)
  •    P00736    Asn-125     Complement c1r subcomponent / Homo sapiens
• ALSNISLR (8aa)
  •    O15031    Asn-127     Plexin-B2 / Homo sapiens
• KLHINHNNLTESVGPLPK (18aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• LHINHNNLTESVGPLPK (17aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• TINQSSDEIQISMGNAMFVK (20aa)
  •    P01011    Asn-127     Alpha-1-antichymotrypsin / Homo sapiens
• NVTYRPHCHICFTPR (15aa)
  •    Q9NZK5    Asn-127     Adenosine deaminase 2 / Homo sapiens
• FGCEIENNR (9aa)
  •    P25311    Asn-128     Zinc-alpha-2-glycoprotein / Homo sapiens
• VMVDLCNSTK (10aa)
  •    Q6ZMI3    Asn-130     Gliomedin [Cleaved into: Gliomedin shedded ectodomain] / Homo sapiens
• NNSIYVVANIGDK (13aa)
  •    O95497    Asn-130     Pantetheinase / Homo sapiens
• KNNHTASILDRM (12aa)
  •    P08962    Asn-130     CD63 antigen / Homo sapiens
• LGCQHHCVPTLDGPTCYCNSSFQLQADGK (29aa)
  •    Q07954    Asn-136     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
• QKYELRVDLEDFENNTAYAK (20aa)
  •    P55083    Asn-137     Microfibril-associated glycoprotein 4 / Homo sapiens
• NFTEVEENMSVQGGLSESAPQSNFSYTQPAMENIQVR (37aa)
  •    Q9HCE0    Asn-137     Ectopic P granules protein 5 homolog / Homo sapiens
• IEDINGCPK (9aa)
  •    Q8IVL1    Asn-137     Neuron navigator 2 / Homo sapiens
• VDIEDFENNTAYAK (14aa)
  •    P55083    Asn-137     Microfibril-associated glycoprotein 4 / Homo sapiens
• KEHEGAIYPDNTTDFQRA (18aa)
  •    P00450    Asn-138     Ceruloplasmin / Homo sapiens
• KEHEGAIYPDNTTDFQRADDKV (22aa)
  •    P00450    Asn-138     Ceruloplasmin / Homo sapiens
• EHEGAIYPDNTTDFQR (16aa)
  •    P00450    Asn-138     Ceruloplasmin / Homo sapiens
• NVSVEALASALQLLAR (16aa)
  •    Q13790    Asn-139     Apolipoprotein F / Homo sapiens
• QQYNALLSNMSR (12aa)
  •    P12821    Asn-146     Angiotensin-converting enzyme / Homo sapiens
• IISNASCTTNCLAPLAK (17aa)
  •    P04406    Asn-149     Glyceraldehyde-3-phosphate dehydrogenase / Homo sapiens
• YHKNNKSWMESEF (13aa)
  •    P0DTC2    Asn-149     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• HTNYSFSPWHGFTIHR (16aa)
  •    P07333    Asn-153     Macrophage colony-stimulating factor 1 receptor / Homo sapiens
• TAGWNVPIGTIRPFINWTGPPEPIEAAVAR (30aa)
  •    P02788    Asn-156     Lactotransferrin / Homo sapiens
• VCQDCPIIAPINDTR (15aa)
  •    P02765    Asn-156     Alpha-2-HS-glycoprotein / Homo sapiens
• KVCQDCPLLAPLNDTRV (17aa)
  •    P02765    Asn-156     Alpha-2-HS-glycoprotein / Homo sapiens
• RRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (33aa)
  •    P02788    Asn-156     Lactotransferrin / Homo sapiens
• RTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (32aa)
  •    P02788    Asn-156     Lactotransferrin / Homo sapiens
• VCQDCPLLAPLNDTR (15aa)
  •    P02765    Asn-156     Alpha-2-HS-glycoprotein / Homo sapiens
• IGSFEGIVNITFIHIQHNR (19aa)
  •    P51884    Asn-160     Lumican / Homo sapiens
• AGPNGTLFVADAYK (14aa)
  •    Q9HDC9    Asn-160     Adipocyte plasma membrane-associated protein / Homo sapiens
• VYKPSAGNNSLYR (13aa)
  •    P02749    Asn-162     Beta-2-glycoprotein 1 / Homo sapiens
• RVYKPSAGNNSLYRD (15aa)
  •    P02749    Asn-162     Beta-2-glycoprotein 1 / Homo sapiens
• VYSSANNCTFE (11aa)
  •    P0DTC2    Asn-165     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• IYIDHNNITR (10aa)
  •    Q06828    Asn-166     Fibromodulin / Homo sapiens
• GNFSTEGCGCVCEPGWK (17aa)
  •    P24821    Asn-166     Tenascin / Homo sapiens
• HGIQYFNNNTQHSSLFMLNEVK (22aa)
  •    P01042    Asn-169     Kininogen-1 / Homo sapiens
• HGIQYFNNNTQHSSLFTLNEVK (22aa)
  •    P01042    Asn-169     Kininogen-1 / Homo sapiens
  •    VAR_019278   178:M→T   dbSNP:rs1656922
• FVACQMELLHSNGSQR (16aa)
  •    P07307    Asn-170     Asialoglycoprotein receptor 2 / Homo sapiens
• SDNGSYICK (9aa)
  •    Q12866    Asn-170     Tyrosine-protein kinase Mer / Homo sapiens
• AALAAFNAQNNGSNFQLEEISR (22aa)
  •    P02765    Asn-176     Alpha-2-HS-glycoprotein / Homo sapiens
• AAPAPQEATATFNSTADR (18aa)
  •    P13598    Asn-176     Intercellular adhesion molecule 2 / Homo sapiens
• LSDLSINSTECLHVHCR (17aa)
  •    P05156    Asn-177     Complement factor i / Homo sapiens
• DSIMENGTLCYEVHYR (16aa)
  •    Q93070    Asn-178     Ecto-ADP-ribosyltransferase 4 / Homo sapiens
• CRGLVGSKNVSSE (13aa)
  •    P08637    Asn-180     Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
  •    VAR_003960   176:F→V   dbSNP:rs396991
• GSKNVSSE (8aa)
  •    P08637    Asn-180     Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
• NITGLENFTLK (11aa)
  •    Q96J42    Asn-181     Thioredoxin domain-containing protein 15 / Homo sapiens
• TPEYYPNAGLIMNYCR (16aa)
  •    P08519    Asn-183     Apolipoprotein (a) / Homo sapiens
• MVSHHNLTTGATLINEQWLLTTAK (24aa)
  •    P00738    Asn-184     Haptoglobin / Homo sapiens
• EHAVFTSNQEEQDPANHTCGVK (22aa)
  •    O15204    Asn-184     ADAM DEC1 / Homo sapiens
• LPPGLLANFTLLR (13aa)
  •    P02750    Asn-186     Leucine-rich alpha-2-glycoprotein / Homo sapiens
• TVNITITQGLA (11aa)
  •    P08637    Asn-187     Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
• SWPAVGNCSSALR (13aa)
  •    P02790    Asn-187     Hemopexin / Homo sapiens
• NESLETYPVMK (11aa)
  •    P05026    Asn-193     Sodium/potassium-transporting ATPase subunit beta-1 / Homo sapiens
• NASNMEYR (8aa)
  •    Q9Y639    Asn-197     Neuroplastin / Homo sapiens
• LQLDCRPLEGNSTVTGQPR (19aa)
  •    P58166    Asn-198     Inhibin beta E chain / Homo sapiens
• NCSFSIIYPVVIK (13aa)
  •    P24387    Asn-204     Corticotropin-releasing factor-binding protein / Homo sapiens
• ITYSIVQTNCSK (12aa)
  •    P01042    Asn-205     Kininogen-1 / Homo sapiens
• LNDTLLMCLK (10aa)
  •    P48357    Asn-206     Leptin receptor / Homo sapiens
• NWCAYVHTR (9aa)
  •    Q13201    Asn-209     Multimerin-1 / Homo sapiens
• KLNNLTFLYLDHNALESVPLNLPESLR (27aa)
  •    P20774    Asn-214     Mimecan / Homo sapiens
• TNSTFVQALVEHVK (14aa)
  •    P07602    Asn-215     Prosaposin / Homo sapiens
• VVIGANGTYSCIVR (14aa)
  •    Q5ZPR3    Asn-215     CD276 antigen / Homo sapiens
• KNVSCYIQNLLLGQEKK (17aa)
  •    Q13410    Asn-215     Butyrophilin subfamily 1 member A1 / Homo sapiens
• VEMANLLNLSER (12aa)
  •    P14651    Asn-226     Homeobox protein Hox-B3 / Homo sapiens
• CNTAAPMWLNGTHPSSDEGIVSR (23aa)
  •    P07911    Asn-232     Uromodulin / Homo sapiens
• NYNENLTLIR (10aa)
  •    O15204    Asn-237     ADAM DEC1 / Homo sapiens
• DTFVNASR (8aa)
  •    P05155    Asn-238     Plasma protease c1 inhibitor / Homo sapiens
• VVLHPNYSQVDIGLIK (16aa)
  •    P00738    Asn-241     Haptoglobin / Homo sapiens
• NISDGFDGIPDNVDAALALPAHSYSGR (27aa)
  •    P04004    Asn-242     Vitronectin / Homo sapiens
• FEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGR (39aa)
  •    P04004    Asn-242     Vitronectin / Homo sapiens
• HLNGTITAK (9aa)
  •    Q6YHK3    Asn-247     CD109 antigen / Homo sapiens
• GCSSSTSVLLTLDNNVVNGSSPAIR (25aa)
  •    P07996    Asn-248     Thrombospondin-1 / Homo sapiens
• KDNTTVTR (8aa)
  •    P11279    Asn-249     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• TTEFDTNSTDIALK (14aa)
  •    Q9HBW9    Asn-249     Adhesion G protein-coupled receptor L4 / Homo sapiens
• KDFEDIYTPVNGSIVIVR (18aa)
  •    P02786    Asn-251     Transferrin receptor protein 1 / Homo sapiens
• ISHNEIADSGIPGNSFNVSSIVEIDISYNK (30aa)
  •    P51884    Asn-252     Lumican / Homo sapiens
• DQNTPVVHPPPTPGSCGHGGVVNISK (26aa)
  •    Q6UX06    Asn-253     Olfactomedin-4 / Homo sapiens
• IGNWSAMPSCK (11aa)
  •    P02749    Asn-253     Beta-2-glycoprotein 1 / Homo sapiens
• VLSNNSDANLELINTWVAK (19aa)
  •    P05155    Asn-253     Plasma protease c1 inhibitor / Homo sapiens
• KLENSLLDHRNKT (13aa)
  •    P23280    Asn-256     Carbonic anhydrase 6 / Homo sapiens
• IININPNK (8aa)
  •    P11279    Asn-261     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• IGISFNSISAVDNGSIANTPHIR (23aa)
  •    P07585    Asn-262     Decorin / Homo sapiens
• GLSFNSISAVDNGSLANTPHLR (22aa)
  •    P07585    Asn-262     Decorin / Homo sapiens
• QVLDNLTMEK (10aa)
  •    P35527    Asn-266     Keratin, type I cytoskeletal 9 / Homo sapiens
• VIDLWDLAQSANLTDK (16aa)
  •    P30533    Asn-268     Alpha-2-macroglobulin receptor-associated protein / Homo sapiens
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270     Biglycan / Homo sapiens
• YTGNASALFILPDQDK (16aa)
  •    P01011    Asn-271     Alpha-1-antichymotrypsin / Homo sapiens
• YLGNATAIFFLPDEGK (16aa)
  •    P01009    Asn-271     Alpha-1-antitrypsin / Homo sapiens
• KYTGNASALFILPDQDKM (18aa)
  •    P01011    Asn-271     Alpha-1-antichymotrypsin / Homo sapiens
• DMSDEVGCVNVTLCEGPNK (19aa)
  •    P01130    Asn-272     Low-density lipoprotein receptor / Homo sapiens
• STGNLSTYNCQLLK (14aa)
  •    Q93070    Asn-274     Ecto-ADP-ribosyltransferase 4 / Homo sapiens
• VIHNGTIAEIQGIPHIR (17aa)
  •    Q13641    Asn-275     Trophoblast glycoprotein / Homo sapiens
• LNSSTIK (7aa)
  •    P13473    Asn-275     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• ERPPTFLTPEGNASNK (16aa)
  •    Q92823    Asn-276     Neuronal cell adhesion molecule / Homo sapiens
• YSENSTTVIR (10aa)
  •    P48357    Asn-276     Leptin receptor / Homo sapiens
• IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
  •    P53634    Asn-276     Dipeptidyl peptidase 1 / Homo sapiens
• ITDIENGSIANIPR (14aa)
  •    Q9BXN1    Asn-282     Asporin / Homo sapiens
• SGNNNGSEPSDIIIPLR (17aa)
  •    P52799    Asn-282     Ephrin-B2 / Homo sapiens
• MNASFSLK (8aa)
  •    P22413    Asn-285     Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 / Homo sapiens
• NVSVAEGK (8aa)
  •    Q9P2B2    Asn-286     Prostaglandin F2 receptor negative regulator / Homo sapiens
• YTGNPTK (7aa)
  •    Q9UHG3    Asn-288     Prenylcysteine oxidase 1 / Homo sapiens
• CFLGNGTGYR (10aa)
  •    Q04756    Asn-290     Hepatocyte growth factor activator / Homo sapiens
• LNAENNATFYFK (12aa)
  •    P01042    Asn-294     Kininogen-1 / Homo sapiens
• GFSTQVLLGDVYQSPCTMAQRPQNFNSSAR (30aa)
  •    Q9Y5L3    Asn-294     Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
• NQTHYALQASLK (12aa)
  •    Q6P179    Asn-294     Endoplasmic reticulum aminopeptidase 2 / Homo sapiens
• INAENNATFYFK (12aa)
  •    P01042    Asn-294     Kininogen-1 / Homo sapiens
• GNLTYGYVTILNGSDIR (17aa)
  •    P08648    Asn-297     Integrin alpha-5 / Homo sapiens
• GYNFSR (6aa)
  •    P36268    Asn-297     Inactive gamma-glutamyltranspeptidase 2 / Homo sapiens
  •    A6NGU5    Asn-297     Putative gamma-glutamyltranspeptidase 3 / Homo sapiens
  •    P19440    Asn-297     Gamma-glutamyltranspeptidase 1 / Homo sapiens
• YIQVVYLHNNNISVVGSSDFCPPGHNTK (28aa)
  •    P07585    Asn-303     Decorin / Homo sapiens
• NATGDYK (7aa)
  •    Q13740    Asn-306     CD166 antigen / Homo sapiens
• IIQVVYIHSNNITK (14aa)
  •    P21810    Asn-311     Biglycan / Homo sapiens
• LQVVYLHSNNITK (13aa)
  •    P21810    Asn-311     Biglycan / Homo sapiens
• NETLALPAESK (11aa)
  •    Q7Z7G0    Asn-313     Target of Nesh-SH3 / Homo sapiens
• LWNFTMNAK (9aa)
  •    Q86SQ4    Asn-314     G-protein coupled receptor 126 / Homo sapiens
• NINYTER (7aa)
  •    P80108    Asn-321     Phosphatidylinositol-glycan-specific phospholipase D / Homo sapiens
• SCPACPGSNITIR (13aa)
  •    P05164    Asn-323     Myeloperoxidase / Homo sapiens
• VTQVYAENGTVLQGSTVASVYK (22aa)
  •    P27169    Asn-324     Serum paraoxonase/arylesterase 1 / Homo sapiens
• VLNFTTK (7aa)
  •    P13671    Asn-324     Complement component c6 / Homo sapiens
• INGTQICPNDIVAFHDFSSDIENVPHIR (28aa)
  •    P51888    Asn-327     Prolargin / Homo sapiens
• FSIYTALFNNMTSVSK (16aa)
  •    Q8IZF2    Asn-328     Adhesion G protein-coupled receptor F5 / Homo sapiens
• FFAENETWVVDSCTTCTCK (19aa)
  •    P35442    Asn-330     Thrombospondin-2 / Homo sapiens
• RFPNIT (6aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• IIDNNKTEK (9aa)
  •    P07602    Asn-332     Prosaposin / Homo sapiens
• MVNMTK (6aa)
  •    Q8IXL6    Asn-335     Extracellular serine/threonine protein kinase FAM20C / Homo sapiens
• IHVGNYNGTAGDAIR (15aa)
  •    Q14314    Asn-336     Fibroleukin / Homo sapiens
• LHVGNYNGTAGDALR (15aa)
  •    Q14314    Asn-336     Fibroleukin / Homo sapiens
• LAGKPTHVNVSVVMAEVDGTC (21aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• YNATVYSQAANGTEGQPQAIEFR (23aa)
  •    Q12913    Asn-342     Receptor-type tyrosine-protein phosphatase eta / Homo sapiens
• GEVFNATR (8aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VFNATR (6aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGSQAFVHWQEPR (13aa)
  •    P30530    Asn-345     Tyrosine-protein kinase receptor UFO / Homo sapiens
• VGQLQLSHNLSLVILVPQNLK (21aa)
  •    P05155    Asn-352     Plasma protease c1 inhibitor / Homo sapiens
• QGNNHTCTWK (10aa)
  •    Q16610    Asn-354     Extracellular matrix protein 1 / Homo sapiens
• MINTSSIIEQINEQFNWVSR (20aa)
  •    P10909    Asn-354     Clusterin / Homo sapiens
• NMSNQLGLLAVNQR (14aa)
  •    P05164    Asn-355     Myeloperoxidase / Homo sapiens
• NATVVWMK (8aa)
  •    Q13740    Asn-361     CD166 antigen / Homo sapiens
• DASSFIAEWQNITK (14aa)
  •    P08195    Asn-365     4F2 cell-surface antigen heavy chain / Homo sapiens
• MNDTIFGFTMEER (13aa)
  •    P20061    Asn-369     Transcobalamin-1 / Homo sapiens
• LANLTQGEDQYYLR (14aa)
  •    P10909    Asn-374     Clusterin / Homo sapiens
• IANITQGEDQYYIR (14aa)
  •    P10909    Asn-374     Clusterin / Homo sapiens
• RLANLTQGEDQYYLRV (16aa)
  •    P10909    Asn-374     Clusterin / Homo sapiens
• NLSDVATK (8aa)
  •    P14923    Asn-378     Junction plakoglobin / Homo sapiens
• TSMGLPVATLQQLEAAAVNVCNQTWAQLQAR (31aa)
  •    Q9Y5L3    Asn-378     Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
• LVPHMNVSAVEK (12aa)
  •    Q96KN2    Asn-382     Beta-Ala-His dipeptidase / Homo sapiens
• HTDDITSINNTIANIR (16aa)
  •    Q5KU26    Asn-386     Collectin-12 / Homo sapiens
• ANYTILK (7aa)
  •    Q02487    Asn-392     Desmocollin-2 / Homo sapiens
• TVNSSHYR (8aa)
  •    Q6QNK2    Asn-394     Adhesion G-protein coupled receptor D1 / Homo sapiens
• ENLTAPGSDSAVFFEQGTTR (20aa)
  •    P00450    Asn-397     Ceruloplasmin / Homo sapiens
• GLNLTEDTYKPR (12aa)
  •    Q08380    Asn-398     Galectin-3-binding protein / Homo sapiens
• YKGLNLTEDTYKPR (14aa)
  •    Q08380    Asn-398     Galectin-3-binding protein / Homo sapiens
• VDIIVANLTVTDK (13aa)
  •    P19022    Asn-402     Cadherin-2 / Homo sapiens
• TMVFPVMYLNESVHIDK (17aa)
  •    Q14108    Asn-412     Lysosome membrane protein 2 / Homo sapiens
• NFTENDLLVR (10aa)
  •    P00734    Asn-416     Prothrombin / Homo sapiens
• VFIVPVGNHSNIPFSR (16aa)
  •    Q96BZ4    Asn-417     Phospholipase D4 / Homo sapiens
• INYTVPQSGTFK (12aa)
  •    Q6YHK3    Asn-419     CD109 antigen / Homo sapiens
• LSLLEEPGNGTFTVILNQLTSR (22aa)
  •    P01833    Asn-421     Polymeric immunoglobulin receptor / Homo sapiens
• RLSLLEEPGNGTFTVILNQLTSRD (24aa)
  •    P01833    Asn-421     Polymeric immunoglobulin receptor / Homo sapiens
• ENVSMVDYAHNNYQAQSAVPLR (22aa)
  •    P05186    Asn-430     Alkaline phosphatase, tissue-nonspecific isozyme / Homo sapiens
• VNESVVSIAAQQK (13aa)
  •    Q13201    Asn-431     Multimerin-1 / Homo sapiens
• CGIVPVIAENYNK (13aa)
  •    P02787    Asn-432     Serotransferrin / Homo sapiens
• HIPGLIHNMTAR (12aa)
  •    Q16610    Asn-444     Extracellular matrix protein 1 / Homo sapiens
• SDFSQTMLFQANTTR (15aa)
  •    P23470    Asn-444     Receptor-type tyrosine-protein phosphatase gamma / Homo sapiens
• VYSGILNQSEIK (12aa)
  •    P03951    Asn-450     Coagulation factor XI / Homo sapiens
• ALPQPQNVTSLLGCTH (16aa)
  •    P02790    Asn-453     Hemopexin / Homo sapiens
• APQHVVNHLPPYTNVSLK (18aa)
  •    Q15262    Asn-462     Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
• LTDTICGVGNMSANASDQER (20aa)
  •    P06681    Asn-467     Complement C2 / Homo sapiens
• VPGNVTAVIGETIK (14aa)
  •    P01833    Asn-469     Polymeric immunoglobulin receptor / Homo sapiens
• KVPGNVTAVLGETLKV (16aa)
  •    P01833    Asn-469     Polymeric immunoglobulin receptor / Homo sapiens
• IIISPEENVTITCTAENQIER (21aa)
  •    Q13740    Asn-480     CD166 antigen / Homo sapiens
• NFTEVHPDYGSHIQALLDK (19aa)
  •    P04040    Asn-481     Catalase / Homo sapiens
• SAPPSQVWNMTVSMTSDNSMHVK (23aa)
  •    P08575    Asn-490     Receptor-type tyrosine-protein phosphatase C / Homo sapiens
• IFSWMQTNNSSHWTEFLWFIQMSQNQPYHR (30aa)
  •    Q6R2W3    Asn-490     SCAN domain-containing protein 3 / Homo sapiens
• ANSTGTLVITDPTR (14aa)
  •    Q12860    Asn-494     Contactin-1 / Homo sapiens
• TAGWNIPMGIIFNQTGSCK (19aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• KWNNTGCQALPSQDEGPSKA (20aa)
  •    P01833    Asn-499     Polymeric immunoglobulin receptor / Homo sapiens
• YGNPNETQNNSTSWPVFK (18aa)
  •    P06276    Asn-509     Cholinesterase / Homo sapiens
• LHNQLLPNVTTVER (14aa)
  •    P19440    Asn-511     Gamma-glutamyltranspeptidase 1 / Homo sapiens
• QNSTMFSLTPENSWTPK (17aa)
  •    Q6YHK3    Asn-513     CD109 antigen / Homo sapiens
• VFGSQNLTTVK (11aa)
  •    Q9Y4L1    Asn-515     Hypoxia up-regulated protein 1 / Homo sapiens
• LPTQNITFQTESSVAEQEAEFQSPK (25aa)
  •    Q14624    Asn-517     Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
• SCSLEGNPVACINLSFCLNASGK (23aa)
  •    P08648    Asn-518     Integrin alpha-5 / Homo sapiens
• LDFIILNETK (10aa)
  •    P27487    Asn-520     Dipeptidyl peptidase 4 / Homo sapiens
• DQCIVDDITYNVNDTFHK (18aa)
  •    P02751    Asn-528     Fibronectin / Homo sapiens
• IYPITWNGSICMR (13aa)
  •    Q8IUX7    Asn-528     Adipocyte enhancer-binding protein 1 / Homo sapiens
• FILNTENNFTLTDNHDNTANITVK (24aa)
  •    P33151    Asn-535     Cadherin-5 / Homo sapiens
• SHGVQTMVVLNNLEPNTTYEIR (22aa)
  •    O15394    Asn-562     Neural cell adhesion molecule 2 / Homo sapiens
• IPEDGSLNTTK (11aa)
  •    P37173    Asn-564     TGF-beta receptor type-2 / Homo sapiens
• DDAGNYTCIASNGPQGQIR (19aa)
  •    Q13308    Asn-567     Inactive tyrosine-protein kinase 7 / Homo sapiens
• INNLTVSLEMEK (12aa)
  •    Q13201    Asn-576     Multimerin-1 / Homo sapiens
• EVNDTLLVNELK (12aa)
  •    Q15063    Asn-599     Periostin / Homo sapiens
• TCPAGVMGENNTLVWK (16aa)
  •    P00533    Asn-603     Epidermal growth factor receptor / Homo sapiens
• QQQHLFGSNVTDCSGNFCLFR (21aa)
  •    P02787    Asn-630     Serotransferrin / Homo sapiens
• QQQHIFGSNVTDCSGNFCIFR (21aa)
  •    P02787    Asn-630     Serotransferrin / Homo sapiens
• NSSVEAFK (8aa)
  •    P42892    Asn-632     Endothelin-converting enzyme 1 / Homo sapiens
• KFGRNGSDCPDKF (13aa)
  •    P02788    Asn-642     Lactotransferrin / Homo sapiens
• TMFPNLTDVR (10aa)
  •    P06681    Asn-651     Complement C2 / Homo sapiens
• NNSYECDIPI (10aa)
  •    P0DTC2    Asn-657     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NVTLLWK (7aa)
  •    P48357    Asn-659     Leptin receptor / Homo sapiens
• KDTCTQECSYFNITK (15aa)
  •    P05556    Asn-669     Integrin beta-1 / Homo sapiens
• NVSVDSTHPTK (11aa)
  •    Q7Z7G0    Asn-690     Target of Nesh-SH3 / Homo sapiens
• NATITQYQLK (10aa)
  •    Q02763    Asn-691     Angiopoietin-1 receptor / Homo sapiens
• NMQIANHTLK (10aa)
  •    P12821    Asn-695     Angiotensin-converting enzyme / Homo sapiens
• DQDPASFGADSLLLNSSR (18aa)
  •    O43451    Asn-707     Maltase-glucoamylase, intestinal / Homo sapiens
• FDVNQLQNTTIK (12aa)
  •    P12821    Asn-714     Angiotensin-converting enzyme / Homo sapiens
• NDCISAPINSLLQMAK (16aa)
  •    Q8IZF2    Asn-718     Adhesion G protein-coupled receptor F5 / Homo sapiens
• IETILLNGTDR (11aa)
  •    Q07954    Asn-729     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
• ELHHLQEQNVSNAFLDK (17aa)
  •    P00450    Asn-762     Ceruloplasmin / Homo sapiens
• KELHHLQEQNVSNAFLDKG (19aa)
  •    P00450    Asn-762     Ceruloplasmin / Homo sapiens
• NESVHPFSPFEVK (13aa)
  •    Q8IWV2    Asn-764     Contactin-4 / Homo sapiens
• RPASNVSASIQR (12aa)
  •    Q16363    Asn-810     Laminin subunit alpha-4 / Homo sapiens
• DNIGSQYLLNWCVQIAK (17aa)
  •    P00533    Asn-816     Epidermal growth factor receptor / Homo sapiens
• FCNESMGDCGPTGLAQHCHLHAR (23aa)
  •    Q9NY15    Asn-816     Stabilin-1 / Homo sapiens
• LNQSNFQK (8aa)
  •    Q13201    Asn-816     Multimerin-1 / Homo sapiens
• LSALDNLLNHSSMFLK (16aa)
  •    Q9Y4L1    Asn-830     Hypoxia up-regulated protein 1 / Homo sapiens
• SAIIEFACTHNIGNCSTTAMK (21aa)
  •    Q9UIQ6    Asn-834     Leucyl-cystinyl aminopeptidase / Homo sapiens
• IFDDWMASNGTQSIPTDVMTTVFK (24aa)
  •    Q9UIQ6    Asn-850     Leucyl-cystinyl aminopeptidase / Homo sapiens
• TVGNQTSTK (9aa)
  •    Q8IWV2    Asn-858     Contactin-4 / Homo sapiens
• IPCSQPPQIEHGTINSSR (18aa)
  •    P08603    Asn-882     Complement factor h / Homo sapiens
• HLVNISVYAFNK (12aa)
  •    P54289    Asn-888     Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens
• AYNSAGAGPFSATVNVTTK (19aa)
  •    Q9P232    Asn-895     Contactin-3 / Homo sapiens
• ISEENETTCYMGK (13aa)
  •    P08603    Asn-911     Complement factor h / Homo sapiens
• DENESPIPCFLAGDHR (16aa)
  •    Q92626    Asn-964     Peroxidasin homolog / Homo sapiens
• DINSQQELQNITTDTR (16aa)
  •    P10586    Asn-966     Receptor-type tyrosine-protein phosphatase F / Homo sapiens
• NVSTTLSTVGAR (12aa)
  •    Q9UQP3    Asn-1052     Tenascin-N / Homo sapiens
• TASCSNVTCWIK (12aa)
  •    P17301    Asn-1057     Integrin alpha-2 / Homo sapiens
• ASTEQAPELENLTVTEVGWDGLR (23aa)
  •    P24821    Asn-1079     Tenascin / Homo sapiens
• NGTHWFV (7aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• TEAGAFEYVPDPTFENFTGGVK (22aa)
  •    O15031    Asn-1099     Plexin-B2 / Homo sapiens
• NETHNPTVK (9aa)
  •    P08581    Asn-1171     Hepatocyte growth factor receptor / Homo sapiens
• VYCNLSAAHTFEDLK (15aa)
  •    Q92626    Asn-1178     Peroxidasin homolog / Homo sapiens
• DLDMFINASK (10aa)
  •    O75882    Asn-1198     Attractin / Homo sapiens
• GTDYINASYIMGYYR (15aa)
  •    P23470    Asn-1207     Receptor-type tyrosine-protein phosphatase gamma / Homo sapiens
• TIAGENQTAFEIEEINR (17aa)
  •    P11047    Asn-1223     Laminin subunit gamma-1 / Homo sapiens
• VEAAQNLTLPGSLR (14aa)
  •    P24821    Asn-1392     Tenascin / Homo sapiens
• VEAAQNITIPGSIR (14aa)
  •    P24821    Asn-1392     Tenascin / Homo sapiens
• VSNQTLSLFFTVLQDVPVR (19aa)
  •    P01023    Asn-1424     Alpha-2-macroglobulin / Homo sapiens
• IIETVEYNISGAER (14aa)
  •    P24821    Asn-1485     Tenascin / Homo sapiens
• WTGHNVTVVQR (11aa)
  •    Q07954    Asn-1511     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
• NMTALEK (7aa)
  •    P24043    Asn-1810     Laminin subunit alpha-2 / Homo sapiens
• NSTTLVMHMK (10aa)
  •    Q07954    Asn-1825     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
• SSNVSYK (7aa)
  •    P11717    Asn-2348     Cation-independent mannose-6-phosphate receptor / Homo sapiens
• NLSMK (5aa)
  •    P24043    Asn-2478     Laminin subunit alpha-2 / Homo sapiens
• MEACMLNGTVIGPGK (15aa)
  •    P04275    Asn-2585     Von willebrand factor / Homo sapiens
• EAGNITTDGYEIIGK (15aa)
  •    Q99715    Asn-2679     Collagen alpha-1(XII) chain / Homo sapiens
• TAIFAFNISHVSNK (14aa)
  •    P35555    Asn-2767     Fibrillin-1 / Homo sapiens
• KPNPVMNGSIK (11aa)
  •    Q4LDE5    Asn-2779     Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 / Homo sapiens
• GCHINECLSR (10aa)
  •    Q07954    Asn-2942     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
• LNLDGSNYTLLK (12aa)
  •    Q07954    Asn-3048     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
• FVEGSHNSTVSLTTK (15aa)
  •    P04114    Asn-3411     Apolipoprotein B-100 / Homo sapiens
• ALNLTEGFAVLHWK (14aa)
  •    P22105    Asn-3855     Tenascin-X / Homo sapiens
• TPENYPNAGLTENYCR (16aa)
  •    P08519    Asn-4057     Apolipoprotein (a) / Homo sapiens
• ENLCLNLHK (9aa)
  •    P04114    Asn-4351     Apolipoprotein B-100 / Homo sapiens