taxonomy (7)
protein (218)
source (30)
structure (40)
composition (1)
disease (16)
reference (50)
site (346)
peptide (329)
- Homo sapiens (Human)
- Desmodus rotundus (Common vampire bat)
- Mus musculus (House mouse)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Friend murine leukemia virus (F-mulv)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- 4F2 cell-surface antigen heavy chain / Homo sapiens P08195
- ADAM DEC1 / Homo sapiens O15204
- Adenosine deaminase 2 / Homo sapiens Q9NZK5
- Adhesion G protein-coupled receptor F5 / Homo sapiens Q8IZF2
- Adhesion G protein-coupled receptor L4 / Homo sapiens Q9HBW9
- Adhesion G-protein coupled receptor D1 / Homo sapiens Q6QNK2
- Adipocyte enhancer-binding protein 1 / Homo sapiens Q8IUX7
- Adipocyte plasma membrane-associated protein / Homo sapiens Q9HDC9
- Alkaline phosphatase, tissue-nonspecific isozyme / Homo sapiens P05186
- Alpha-1-acid glycoprotein 1 / Homo sapiens P02763
- Alpha-1-acid glycoprotein 2 / Homo sapiens P19652
- Alpha-1-antichymotrypsin / Homo sapiens P01011
- Alpha-1-antitrypsin / Homo sapiens P01009
- Alpha-2-HS-glycoprotein / Homo sapiens P02765
- Alpha-2-macroglobulin / Homo sapiens P01023
- Alpha-2-macroglobulin receptor-associated protein / Homo sapiens P30533
- Alpha-n-acetylgalactosaminidase / Homo sapiens P17050
- Alpha-S1-casein / Homo sapiens P47710
- Angiopoietin-1 receptor / Homo sapiens Q02763
- Angiotensin-converting enzyme / Homo sapiens P12821
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Apolipoprotein (a) / Homo sapiens P08519
- Apolipoprotein B-100 / Homo sapiens P04114
- Apolipoprotein D / Homo sapiens P05090
- Apolipoprotein F / Homo sapiens Q13790
- Asialoglycoprotein receptor 2 / Homo sapiens P07307
- Asporin / Homo sapiens Q9BXN1
- Attractin / Homo sapiens O75882
- Beta-2-glycoprotein 1 / Homo sapiens P02749
- Beta-Ala-His dipeptidase / Homo sapiens Q96KN2
- Biglycan / Homo sapiens P21810
- Butyrophilin subfamily 1 member A1 / Homo sapiens Q13410
- Cadherin-2 / Homo sapiens P19022
- Cadherin-5 / Homo sapiens P33151
- Carbonic anhydrase 6 / Homo sapiens P23280
- Carboxypeptidase b2 / Homo sapiens Q96IY4
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens P06731
- Catalase / Homo sapiens P04040
- Cation-independent mannose-6-phosphate receptor / Homo sapiens P11717
- CD109 antigen / Homo sapiens Q6YHK3
- CD166 antigen / Homo sapiens Q13740
- CD276 antigen / Homo sapiens Q5ZPR3
- CD44 antigen / Homo sapiens P16070
- CD59 glycoprotein / Homo sapiens P13987
- CD63 antigen / Homo sapiens P08962
- Cell adhesion molecule 1 / Homo sapiens Q9BY67
- Ceruloplasmin / Homo sapiens P00450
- Chimeric plasminogen activator K2-tuPA / Homo sapiens P00750 P00749
- Cholinesterase / Homo sapiens P06276
- Clusterin / Homo sapiens P10909
- Coagulation factor VIII / Homo sapiens P00451
- Coagulation factor XI / Homo sapiens P03951
- Collagen alpha-1(XII) chain / Homo sapiens Q99715
- Collectin-12 / Homo sapiens Q5KU26
- Complement c1r subcomponent / Homo sapiens P00736
- Complement C2 / Homo sapiens P06681
- Complement component c6 / Homo sapiens P13671
- Complement factor h / Homo sapiens P08603
- Complement factor i / Homo sapiens P05156
- Contactin-1 / Homo sapiens Q12860
- Contactin-3 / Homo sapiens Q9P232
- Contactin-4 / Homo sapiens Q8IWV2
- Corticotropin-releasing factor-binding protein / Homo sapiens P24387
- Decorin / Homo sapiens P07585
- Desmocollin-2 / Homo sapiens Q02487
- Dipeptidyl peptidase 1 / Homo sapiens P53634
- Dipeptidyl peptidase 4 / Homo sapiens P27487
- Ecto-ADP-ribosyltransferase 4 / Homo sapiens Q93070
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens Q9Y5L3
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 / Homo sapiens P22413
- Ectopic P granules protein 5 homolog / Homo sapiens Q9HCE0
- Endoplasmic reticulum aminopeptidase 2 / Homo sapiens Q6P179
- Endothelin-converting enzyme 1 / Homo sapiens P42892
- Ephrin-B2 / Homo sapiens P52799
- Epidermal growth factor receptor / Homo sapiens P00533
- Epithelial cell adhesion molecule / Homo sapiens P16422
- Erythropoietin / Homo sapiens P01588
- Extracellular matrix protein 1 / Homo sapiens Q16610
- Extracellular serine/threonine protein kinase FAM20C / Homo sapiens Q8IXL6
- Fibrillin-1 / Homo sapiens P35555
- Fibroleukin / Homo sapiens Q14314
- Fibromodulin / Homo sapiens Q06828
- Fibronectin / Homo sapiens P02751
- Fibulin-1 / Homo sapiens P23142
- G-protein coupled receptor 126 / Homo sapiens Q86SQ4
- Galectin-3-binding protein / Homo sapiens Q08380
- Gamma-glutamyltranspeptidase 1 / Homo sapiens P19440
- Gliomedin [Cleaved into: Gliomedin shedded ectodomain] / Homo sapiens Q6ZMI3
- Glyceraldehyde-3-phosphate dehydrogenase / Homo sapiens P04406
- Glycocalicin / Homo sapiens P07359
- Haptoglobin / Homo sapiens P00738
- Hemopexin / Homo sapiens P02790
- Heparin cofactor 2 / Homo sapiens P05546
- Hepatocyte growth factor / Homo sapiens P14210
- Hepatocyte growth factor activator / Homo sapiens Q04756
- Hepatocyte growth factor receptor / Homo sapiens P08581
- HLA class II histocompatibility antigen, DRB1-1 beta chain / Homo sapiens P04229
- HLA class II histocompatibility antigen, DRB1-10 beta chain / Homo sapiens Q30167
- HLA class II histocompatibility antigen, DRB1-9 beta chain / Homo sapiens Q9TQE0
- Homeobox protein Hox-B3 / Homo sapiens P14651
- Hypoxia up-regulated protein 1 / Homo sapiens Q9Y4L1
- Immunoglobulin epsilon chain c region / Homo sapiens P01854
- Immunoglobulin gamma / Homo sapiens P01857 P01860 P01859 P01861
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens P01854
- Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens P01854
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Immunoglobulin superfamily containing leucine-rich repeat protein / Homo sapiens O14498
- Inactive gamma-glutamyltranspeptidase 2 / Homo sapiens P36268
- Inactive tyrosine-protein kinase 7 / Homo sapiens Q13308
- Inhibin beta E chain / Homo sapiens P58166
- Integrin alpha-2 / Homo sapiens P17301
- Integrin alpha-5 / Homo sapiens P08648
- Integrin alpha-5/beta-1 / Homo sapiens P05556 P08648
- Integrin alpha-L / Homo sapiens P20701
- Integrin beta-1 / Homo sapiens P05556
- Integrin beta-2 / Homo sapiens P05107
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens Q14624
- Intercellular adhesion molecule 2 / Homo sapiens P13598
- Interleukin-1 receptor type 2 / Homo sapiens P27930
- Junction plakoglobin / Homo sapiens P14923
- Keratin, type I cytoskeletal 9 / Homo sapiens P35527
- Kininogen-1 / Homo sapiens P01042
- Lactotransferrin / Homo sapiens P02788
- Laminin subunit alpha-2 / Homo sapiens P24043
- Laminin subunit alpha-4 / Homo sapiens Q16363
- Laminin subunit gamma-1 / Homo sapiens P11047
- Leptin receptor / Homo sapiens P48357
- Leucine-rich alpha-2-glycoprotein / Homo sapiens P02750
- Leucyl-cystinyl aminopeptidase / Homo sapiens Q9UIQ6
- Leukocyte-associated immunoglobulin-like receptor 1 / Homo sapiens Q6GTX8
- Lipoprotein lipase / Homo sapiens P06858
- Low-density lipoprotein receptor / Homo sapiens P01130
- Lumican / Homo sapiens P51884
- Lysosome membrane protein 2 / Homo sapiens Q14108
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Macrophage colony-stimulating factor 1 receptor / Homo sapiens P07333
- Maltase-glucoamylase, intestinal / Homo sapiens O43451
- Mammaglobin-A / Homo sapiens Q13296
- Metalloproteinase inhibitor 1 / Homo sapiens P01033
- Microfibril-associated glycoprotein 4 / Homo sapiens P55083
- Mimecan / Homo sapiens P20774
- Multimerin-1 / Homo sapiens Q13201
- Myeloperoxidase / Homo sapiens P05164
- Neural cell adhesion molecule 2 / Homo sapiens O15394
- Neuron navigator 2 / Homo sapiens Q8IVL1
- Neuronal cell adhesion molecule / Homo sapiens Q92823
- Neuroplastin / Homo sapiens Q9Y639
- Olfactomedin-4 / Homo sapiens Q6UX06
- Pantetheinase / Homo sapiens O95497
- Periostin / Homo sapiens Q15063
- Peroxidasin homolog / Homo sapiens Q92626
- Phosphatidylinositol-glycan-specific phospholipase D / Homo sapiens P80108
- Phosphoinositide-3-kinase-interacting protein 1 / Homo sapiens Q96FE7
- Phospholipase D4 / Homo sapiens Q96BZ4
- Phospholipid transfer protein / Homo sapiens P55058
- Plasma protease c1 inhibitor / Homo sapiens P05155
- Platelet endothelial cell adhesion molecule / Homo sapiens P16284
- Plexin-B2 / Homo sapiens O15031
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Prenylcysteine oxidase 1 / Homo sapiens Q9UHG3
- Prolactin-inducible protein / Homo sapiens P12273
- Prolargin / Homo sapiens P51888
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens Q07954
- Prolyl endopeptidase FAP / Homo sapiens Q12884
- Prosaposin / Homo sapiens P07602
- Prostaglandin F2 receptor negative regulator / Homo sapiens Q9P2B2
- Prostaglandin-h2 d-isomerase / Homo sapiens P41222
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens P07288
- Prothrombin / Homo sapiens P00734
- Putative gamma-glutamyltranspeptidase 3 / Homo sapiens A6NGU5
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens P08575
- Receptor-type tyrosine-protein phosphatase eta / Homo sapiens Q12913
- Receptor-type tyrosine-protein phosphatase F / Homo sapiens P10586
- Receptor-type tyrosine-protein phosphatase gamma / Homo sapiens P23470
- Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens Q15262
- SCAN domain-containing protein 3 / Homo sapiens Q6R2W3
- Scavenger receptor cysteine-rich type 1 protein M130 / Homo sapiens Q86VB7
- Semaphorin-6A / Homo sapiens Q9H2E6
- Serotransferrin / Homo sapiens P02787
- Serum paraoxonase/arylesterase 1 / Homo sapiens P27169
- Sodium/potassium-transporting ATPase subunit beta-1 / Homo sapiens P05026
- Sodium/potassium-transporting ATPase subunit beta-3 / Homo sapiens P54709
- Sortilin / Homo sapiens Q99523
- Sparc / Homo sapiens P09486
- Stabilin-1 / Homo sapiens Q9NY15
- Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 / Homo sapiens Q4LDE5
- Target of Nesh-SH3 / Homo sapiens Q7Z7G0
- Tenascin / Homo sapiens P24821
- Tenascin-N / Homo sapiens Q9UQP3
- Tenascin-X / Homo sapiens P22105
- TGF-beta receptor type-2 / Homo sapiens P37173
- Thioredoxin domain-containing protein 15 / Homo sapiens Q96J42
- Thrombopoietin / Homo sapiens P40225
- Thrombospondin-1 / Homo sapiens P07996
- Thrombospondin-2 / Homo sapiens P35442
- Tissue-type plasminogen activator / Homo sapiens P00750
- Transcobalamin-1 / Homo sapiens P20061
- Transferrin receptor protein 1 / Homo sapiens P02786
- Trophoblast glycoprotein / Homo sapiens Q13641
- Tyrosine-protein kinase Mer / Homo sapiens Q12866
- Tyrosine-protein kinase receptor UFO / Homo sapiens P30530
- Uromodulin / Homo sapiens P07911
- Vitronectin / Homo sapiens P04004
- Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens P54289
- Von willebrand factor / Homo sapiens P04275
- WAP four-disulfide core domain protein 2 / Homo sapiens Q14508
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Salivary plasminogen activator alpha 1 / Desmodus rotundus P98119
- Fetal antigen 1 / Mus musculus Q09163
- Neuroligin 1 / Rattus norvegicus Q62765
- Thyroglobulin / Sus scrofa
- Envelope glycoprotein / Friend murine leukemia virus P03395
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Amniotic Fluid (UBERON_0000173)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Colon (UBERON_0001155)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914)
- Kidney (UBERON_0002113) BHK570 (CVCL_6370) Fibroblast (CL_0000057)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Kidney (UBERON_0002113) HEK293-EBNA (CVCL_6974)
- Liver (UBERON_0002107)
- Mammary Gland (UBERON_0001911) C127 (CVCL_6550)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO-DG44 (CVCL_7180)
- Ovary (UBERON_0000992)
- Placenta (UBERON_0001987)
- Seminal Fluid (UBERON_0006530)
- Thyroid (UBERON_0002046)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- Eveline (CVCL_A1LI)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- HEK293T (CVCL_0063)
- LS174T (CVCL_1384)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Platelet (CL_0000233) Plasma Membrane (GO_0005886)
Source
- N-Linked / Complex / Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Fuc + 2 x NeuAc(a2-?)"
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 867
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x NeuAc(a2-3)"
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 2575
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x NeuAc(a2-3)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-3) + NeuAc(a2-6)"
- N-Linked / Complex / Structure 1814
- N-Linked / Complex / Hex(?1-?)HexNAc(?1-?)Man(a1-?)[Hex(?1-?)HexNAc(?1-?)[Hex(?1-?)HexNAc(?1-?)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ 2 x NeuAc"
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-3)"
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-?)"
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-6)"
- N-Linked / Complex / Structure 1712
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ 2 x NeuAc(a2-6)"
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-3)"
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)[Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-3)"
- N-Linked / Complex / Structure 2121
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-?)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-?)Gal(b1-?)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc+"+ Hex + HexNAc"
- N-Linked / Complex / Structure 9324
- N-Linked / Complex / Structure 9451
- N-Linked / Complex / Structure 9840
- N-Linked / Complex / Structure 9851
- N-Linked / Complex / Structure 10040
- N-Linked / Complex / Structure 10232
- N-Linked / Complex / Structure 10595
- N-Linked / Complex / Structure 10690
- N-Linked / Complex / Structure 10752
- N-Linked / Complex / Structure 10888
- N-Linked / Complex / Structure 10897
- N-Linked / Complex / Structure 10913
- N-Linked / Complex / Structure 10973
Reported structure
- Cancer, breast (DOID:1612)
- Carcinoma (DOID:305)
- Carcinoma, Hepatocellular (DOID:684)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Esophageal cancer (DOID:5041)
- Familial hepatic adenoma (DOID:111366)
- Gastritis (DOID:4029)
- Hyperimmune condition
- IgE myeloma (DOID:9538)
- Maturity-onset diabetes of the young type 3 (DOID:0111102)
- Mixed phenotype acute leukemia (DOID:9953)
- Myeloma, Multiple (DOID:9538)
- Prostate cancer (DOID:10283)
- Prostate Disease (DOID:47)
Disease
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena DomÃnguez-Vega) / Status : Reviewed
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Aberrant sialylation in a patient with a HNF1α variant and liver adenomatosis (2021 - Luisa Sturiale, Marie-Cécile Nassogne, Angelo Palmigiano, Angela Messina, Immacolata Speciale, Rosangela Artuso, Gaetano Bertino, Nicole Revencu, Xavier Stephénne, Cristina De Castro, Gert Matthijs, Rita Barone, Jaak Jaeken, Domenico Garozzo) / Status : Reviewed
- Profiling the proteoforms of urinary prostate-specific antigen by capillary electrophoresis – mass spectrometry (2021 - Alan B. Moran, Elena DomÃnguez-Vega, Jan Nouta, Tamas Pongracz, Theo M. de Reijke, Manfred Wuhrer, Guinevere S.M. Lageveen-Kammeijer) / Status : Reviewed
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Cysteine Aminoethylation Enables the Site-Specific Glycosylation Analysis of Recombinant Human Erythropoietin using Trypsin (2020 - Steffen Lippold, Alexander Büttner, Matthew S.F. Choo, Michaela Hook, Coen J. de Jong, Terry Nguyen-Khuong, Markus Haberger, Dietmar Reusch, Manfred Wuhrer, Noortje de Haan) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
- Site-specific N-glycosylation analysis of human factor XI: Identification of a noncanonical NXC glycosite (2014 - Faid V, Denguir N, Chapuis V, Bihoreau N, Chevreux G) / Status : Reviewed
- Computational framework for identification of intact glycopeptides in complex samples (2014 - Mayampurath A, Yu CY, Song E, Balan J, Mechref Y, Tang H.) / Status : Reviewed
- In-depth analysis of site-specific N-glycosylation in vitronectin from human plasma by tandem mass spectrometry with immunoprecipitation (2014 - Hwang H, Lee JY, Lee HK, Park GW, Jeong HK, Moon MH, Kim JY, Yoo JS.) / Status : Reviewed
- Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Quantitative analysis of site-specific N-glycans on sera haptoglobin β chain in liver diseases. (2013 - Zhang S, Jiang K, Sun C, Lu H, Liu Y.) / Status : Reviewed
- Exploring site-specific N-glycosylation microheterogeneity of haptoglobin using glycopeptide CID tandem mass spectra and glycan database search (2013 - Chandler KB1, Pompach P, Goldman R, Edwards N.) / Status : Reviewed
- Determination of site-specific glycan heterogeneity on glycoproteins (2012 - Kolarich D1, Jensen PH, Altmann F, Packer NH.) / Status : Reviewed
- Structural characterization of recombinant soluble rat neuroligin 1: mapping of secondary structure and glycosylation by mass spectrometry. (2004 - Hoffman RC, Jennings LL, Tsigelny I, Comoletti D, Flynn RE, Sudhof TC, Taylor P) / Status : Reviewed
- Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
- Structural determination of N-linked carbohydrates by matrix-assisted laser desorption/ionization-mass spectrometry following enzymatic release within sodium dodecyl sulfate-polyacrylamide electrophoresis gels: application to species-specific glycosylation of alpha1-acid glycoprotein. (1998 - Kuster B, Hunter A, Wheeler S, Dwek R, Harvey D) / Status : Reviewed
- Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
- Glycosylation analysis and protein structure determination of murine fetal antigen 1 (mFA1)--the circulating gene product of the delta-like protein (dlk), preadipocyte factor 1 (Pref-1) and stromal-cell-derived protein 1 (SCP-1) cDNAs. (1997 - Krogh T, Bachmann E, Teisner B, Skjdt K, Hjrup P) / Status : Reviewed
- Elucidation of N-linked oligosaccharide structures of recombinant human factor VIII using fluorophore-assisted carbohydrate electrophoresis. (1996 - Kumar H, Hague C, Haley T, Starr C, Besman M, Lundblad R, Baker D) / Status : Reviewed
- Peptide, disulfide, and glycosylation mapping of recombinant human thrombopoietin from ser1 to Arg246. (1996 - Hoffman RC, Andersen H, Walker K, Krakover JD, Patel S, Stamm MR, Osborn SG) / Status : Reviewed
- Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
- Structural analysis of the sialylated N- and O-linked carbohydrate chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. Sialylation patterns and branch location of dimeric N-acetyllactosamine units. (1995 - Hokke C, Bergwerff A, Van Dedem G, Kamerling J, Vliegenthart J) / Status : Reviewed
- Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
- Structures of sialylated oligosaccharides of human erythropoietin expressed in recombinant BHK-21 cells. (1993 - Nimtz M, Martin W, Wray V, Klppel K, Augustin J, Conradt H) / Status : Reviewed
- Primary structure of N-linked carbohydrate chains of a human chimeric plasminogen activator K2tu-PA expressed in Chinese hamster ovary cells. (1993 - Bergwerff A, van Oostrum J, Asselbergs F, Brgi R, Hokke C, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structural study of the N-linked oligosaccharides of hepatocyte growth factor by two-dimensional sugar mapping. (1993 - Hara H, Nakae Y, Sogabe T, Ihara I, Ueno S, Sakai H, Inoue H, Shimizu S, Nakamura T, Shimizu N) / Status : Reviewed
- The Asn-linked carbohydrate chains of human Tamm-Horsfall glycoprotein of one male. Novel sulfated and novel N-acetylgalactosamine-containing N-linked carbohydrate chains. (1992 - Hard K, Van Zadelhoff G, Moonen P, Kamerling J, Vliegenthart F) / Status : Reviewed
- Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed
- Carbohydrate structures of a human tissue plasminogen activator variant expressed in recombinant Chinese hamster ovary cells. (1990 - Nimtz M, Noll G, Pques E, Conradt H) / Status : Reviewed
- Analysis of N- and O-glycosidically bound sialooligosaccharides in glycoproteins by high-performance liquid chromatography with pulsed amperometric detection. (1990 - Honda S, Suzuki S, Zaiki S, Kakehi K) / Status : Reviewed
- Carbohydrate structure of recombinant human uterine tissue plasminogen activator expressed in mouse epithelial cells. (1989 - Pfeiffer G, Schmidt M, Strube K, Geyer R) / Status : Reviewed
- Identification of a tetrasialylated monofucosylated tetraantennary N-linked carbohydrate chain in human platelet glycocalicin. (1988 - Korrel S, Clemetson K, van Halbeek H, Kamerling J, Sixma J, Vliegenthart J) / Status : Reviewed
- The structures and microheterogeneity of the carbohydrate chains of human plasma ceruloplasmin. A study employing 500-MHz 1H-NMR spectroscopy. (1982 - Endo M, Suzuki K, Schmid K, Fournet B, Karamanos Y, Montreuil J, Dorland L, van Halbeek H, Vliegenthart J) / Status : Reviewed
Reference
- 4F2 cell-surface antigen heavy chain / Homo sapiens
- ADAM DEC1 / Homo sapiens
- Adenosine deaminase 2 / Homo sapiens
- Adhesion G protein-coupled receptor F5 / Homo sapiens
- Adhesion G protein-coupled receptor L4 / Homo sapiens
- Adhesion G-protein coupled receptor D1 / Homo sapiens
- Adipocyte enhancer-binding protein 1 / Homo sapiens
- Adipocyte plasma membrane-associated protein / Homo sapiens
- Alkaline phosphatase, tissue-nonspecific isozyme / Homo sapiens
- Alpha-1-acid glycoprotein 1 / Homo sapiens
- Alpha-1-acid glycoprotein 2 / Homo sapiens
- Alpha-1-antichymotrypsin / Homo sapiens
- Alpha-1-antitrypsin / Homo sapiens
- Alpha-2-HS-glycoprotein / Homo sapiens
- Alpha-2-macroglobulin / Homo sapiens
- Alpha-2-macroglobulin receptor-associated protein / Homo sapiens
-
Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
- Alpha-S1-casein / Homo sapiens
- Angiopoietin-1 receptor / Homo sapiens
- Angiotensin-converting enzyme / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Apolipoprotein (a) / Homo sapiens
- Apolipoprotein B-100 / Homo sapiens
- Apolipoprotein D / Homo sapiens
- Apolipoprotein F / Homo sapiens
- Asialoglycoprotein receptor 2 / Homo sapiens
- Asporin / Homo sapiens
- Attractin / Homo sapiens
- Beta-2-glycoprotein 1 / Homo sapiens
- Beta-Ala-His dipeptidase / Homo sapiens
- Biglycan / Homo sapiens
- Butyrophilin subfamily 1 member A1 / Homo sapiens
- Cadherin-2 / Homo sapiens
- Cadherin-5 / Homo sapiens
- Carbonic anhydrase 6 / Homo sapiens
- Carboxypeptidase b2 / Homo sapiens
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Catalase / Homo sapiens
- Cation-independent mannose-6-phosphate receptor / Homo sapiens
- CD109 antigen / Homo sapiens
- CD166 antigen / Homo sapiens
- CD276 antigen / Homo sapiens
- CD44 antigen / Homo sapiens
- CD59 glycoprotein / Homo sapiens
- CD63 antigen / Homo sapiens
- Cell adhesion molecule 1 / Homo sapiens
- Ceruloplasmin / Homo sapiens
- Chimeric plasminogen activator K2-tuPA / Homo sapiens
- Cholinesterase / Homo sapiens
- Clusterin / Homo sapiens
-
Coagulation factor VIII / Homo sapiens
- Undefined site
- Coagulation factor XI / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collectin-12 / Homo sapiens
- Complement c1r subcomponent / Homo sapiens
- Complement C2 / Homo sapiens
- Complement component c6 / Homo sapiens
- Complement factor h / Homo sapiens
- Complement factor i / Homo sapiens
- Contactin-1 / Homo sapiens
- Contactin-3 / Homo sapiens
- Contactin-4 / Homo sapiens
- Corticotropin-releasing factor-binding protein / Homo sapiens
- Decorin / Homo sapiens
- Desmocollin-2 / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Dipeptidyl peptidase 4 / Homo sapiens
- Ecto-ADP-ribosyltransferase 4 / Homo sapiens
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 / Homo sapiens
- Ectopic P granules protein 5 homolog / Homo sapiens
- Endoplasmic reticulum aminopeptidase 2 / Homo sapiens
- Endothelin-converting enzyme 1 / Homo sapiens
- Ephrin-B2 / Homo sapiens
- Epidermal growth factor receptor / Homo sapiens
- Epithelial cell adhesion molecule / Homo sapiens
- Erythropoietin / Homo sapiens
- Extracellular matrix protein 1 / Homo sapiens
- Extracellular serine/threonine protein kinase FAM20C / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibroleukin / Homo sapiens
- Fibromodulin / Homo sapiens
- Fibronectin / Homo sapiens
- Fibulin-1 / Homo sapiens
- G-protein coupled receptor 126 / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Gamma-glutamyltranspeptidase 1 / Homo sapiens
- Gliomedin [Cleaved into: Gliomedin shedded ectodomain] / Homo sapiens
- Glyceraldehyde-3-phosphate dehydrogenase / Homo sapiens
-
Glycocalicin / Homo sapiens
- Undefined site
- Haptoglobin / Homo sapiens
- Hemopexin / Homo sapiens
- Heparin cofactor 2 / Homo sapiens
- Hepatocyte growth factor / Homo sapiens
- Hepatocyte growth factor activator / Homo sapiens
- Hepatocyte growth factor receptor / Homo sapiens
- HLA class II histocompatibility antigen, DRB1-1 beta chain / Homo sapiens
- HLA class II histocompatibility antigen, DRB1-10 beta chain / Homo sapiens
- HLA class II histocompatibility antigen, DRB1-9 beta chain / Homo sapiens
- Homeobox protein Hox-B3 / Homo sapiens
- Hypoxia up-regulated protein 1 / Homo sapiens
- Immunoglobulin epsilon chain c region / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
-
Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
- Immunoglobulin superfamily containing leucine-rich repeat protein / Homo sapiens
- Inactive gamma-glutamyltranspeptidase 2 / Homo sapiens
- Inactive tyrosine-protein kinase 7 / Homo sapiens
- Inhibin beta E chain / Homo sapiens
- Integrin alpha-2 / Homo sapiens
- Integrin alpha-5 / Homo sapiens
-
Integrin alpha-5/beta-1 / Homo sapiens
- Undefined site
- Integrin alpha-L / Homo sapiens
- Integrin beta-1 / Homo sapiens
- Integrin beta-2 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Intercellular adhesion molecule 2 / Homo sapiens
- Interleukin-1 receptor type 2 / Homo sapiens
- Junction plakoglobin / Homo sapiens
- Keratin, type I cytoskeletal 9 / Homo sapiens
- Kininogen-1 / Homo sapiens
- Lactotransferrin / Homo sapiens
- Laminin subunit alpha-2 / Homo sapiens
- Laminin subunit alpha-4 / Homo sapiens
- Laminin subunit gamma-1 / Homo sapiens
- Leptin receptor / Homo sapiens
- Leucine-rich alpha-2-glycoprotein / Homo sapiens
- Leucyl-cystinyl aminopeptidase / Homo sapiens
- Leukocyte-associated immunoglobulin-like receptor 1 / Homo sapiens
- Lipoprotein lipase / Homo sapiens
- Low-density lipoprotein receptor / Homo sapiens
- Lumican / Homo sapiens
- Lysosome membrane protein 2 / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Macrophage colony-stimulating factor 1 receptor / Homo sapiens
- Maltase-glucoamylase, intestinal / Homo sapiens
- Mammaglobin-A / Homo sapiens
- Metalloproteinase inhibitor 1 / Homo sapiens
- Microfibril-associated glycoprotein 4 / Homo sapiens
- Mimecan / Homo sapiens
- Multimerin-1 / Homo sapiens
- Myeloperoxidase / Homo sapiens
- Neural cell adhesion molecule 2 / Homo sapiens
- Neuron navigator 2 / Homo sapiens
- Neuronal cell adhesion molecule / Homo sapiens
- Neuroplastin / Homo sapiens
- Olfactomedin-4 / Homo sapiens
- Pantetheinase / Homo sapiens
- Periostin / Homo sapiens
- Peroxidasin homolog / Homo sapiens
- Phosphatidylinositol-glycan-specific phospholipase D / Homo sapiens
- Phosphoinositide-3-kinase-interacting protein 1 / Homo sapiens
- Phospholipase D4 / Homo sapiens
- Phospholipid transfer protein / Homo sapiens
- Plasma protease c1 inhibitor / Homo sapiens
- Platelet endothelial cell adhesion molecule / Homo sapiens
- Plexin-B2 / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Prenylcysteine oxidase 1 / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prolargin / Homo sapiens
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
- Prolyl endopeptidase FAP / Homo sapiens
- Prosaposin / Homo sapiens
- Prostaglandin F2 receptor negative regulator / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- Prothrombin / Homo sapiens
- Putative gamma-glutamyltranspeptidase 3 / Homo sapiens
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Receptor-type tyrosine-protein phosphatase eta / Homo sapiens
- Receptor-type tyrosine-protein phosphatase F / Homo sapiens
- Receptor-type tyrosine-protein phosphatase gamma / Homo sapiens
- Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
- SCAN domain-containing protein 3 / Homo sapiens
- Scavenger receptor cysteine-rich type 1 protein M130 / Homo sapiens
- Semaphorin-6A / Homo sapiens
- Serotransferrin / Homo sapiens
- Serum paraoxonase/arylesterase 1 / Homo sapiens
- Sodium/potassium-transporting ATPase subunit beta-1 / Homo sapiens
- Sodium/potassium-transporting ATPase subunit beta-3 / Homo sapiens
- Sortilin / Homo sapiens
- Sparc / Homo sapiens
- Stabilin-1 / Homo sapiens
- Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 / Homo sapiens
- Target of Nesh-SH3 / Homo sapiens
- Tenascin / Homo sapiens
- Tenascin-N / Homo sapiens
- Tenascin-X / Homo sapiens
- TGF-beta receptor type-2 / Homo sapiens
- Thioredoxin domain-containing protein 15 / Homo sapiens
-
Thrombopoietin / Homo sapiens
- Undefined site
- Thrombospondin-1 / Homo sapiens
- Thrombospondin-2 / Homo sapiens
-
Tissue-type plasminogen activator / Homo sapiens
- Undefined site
- Transcobalamin-1 / Homo sapiens
- Transferrin receptor protein 1 / Homo sapiens
- Trophoblast glycoprotein / Homo sapiens
- Tyrosine-protein kinase Mer / Homo sapiens
- Tyrosine-protein kinase receptor UFO / Homo sapiens
-
Uromodulin / Homo sapiens
- Undefined site
- Asn-232
- Vitronectin / Homo sapiens
- Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens
- Von willebrand factor / Homo sapiens
- WAP four-disulfide core domain protein 2 / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
- Salivary plasminogen activator alpha 1 / Desmodus rotundus
- Fetal antigen 1 / Mus musculus
-
Neuroligin 1 / Rattus norvegicus
- Undefined site
-
Thyroglobulin / Sus scrofa
- Undefined site
- Envelope glycoprotein / Friend murine leukemia virus
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- NPNATSSSSQDPESLQDR (18aa)
- LVPVPITNATLDQITGK (17aa)
- LVPVPITNATLDR (13aa)
- NVTLHVPSK (9aa)
- SIVLEPIYWNSSNSK (15aa)
- TAVNCSSDFDACLITK (16aa)
- KTAVNCSSDFDACLITKA (18aa)
- TAVNCSSDFDACIITK (16aa)
- TGVCPELQADQNCTQECVSDSECADNLK (28aa)
- FECHFFNGTER (11aa)
- NLSMPLLPADFHK (13aa)
- DILNGTFSYK (10aa)
- INFTGPGDPDSIR (13aa)
- EAENITTGC (9aa)
- DVNCSVMGPQEK (12aa)
- ELLQEFIDDNATTNAIDELK (20aa)
- KWFYIASAFRNEEYNKS (17aa)
- AFNSTLPTMAQMEK (14aa)
- YETTNK (6aa)
- FSNVTWF (7aa)
- EGHFYYNISEVK (12aa)
- LNGTDVDTGMDFR (13aa)
- LDIQMIMIMNGTLYIAAR (18aa)
- SLNENITVPDTK (12aa)
- CIQANYSIMENGK (13aa)
- INLTWHK (7aa)
- CLNWLDAQSGLASAPVSGAGNHSYCR (26aa)
- NKSVLLGR (8aa)
- STYNDTEDVSQASPSESEAR (20aa)
- NK (2aa)
- KDTRNESTQNCVVAEPEKM (19aa)
- RTPEDTAEDTCHLIPGVAESVATCHFNHSSKT (32aa)
- SVQEIQATFFYFTPNKTEDTIFLR (24aa)
- SVQEIQATFFYFTPNK (16aa)
- YFTPNKTEDTIFLR (14aa)
- KQVHFFVNASDVDNVK (16aa)
- HAIHVSGTNGTKRF (14aa)
- AEMNGSK (7aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- NGTHFDIDK (9aa)
- DDVLFYNISSMK (12aa)
- SSCGKENTSDPSIVIAFGR (19aa)
- NNATVHEQVGGPSLTSDLQAQSK (23aa)
- KNNATVHEQVGGPSLTSDLQAQSKG (25aa)
- KKKEDALNETRE (12aa)
- KKKEDALNETRESETKL (17aa)
- KEDALNETRESETKL (15aa)
- KEDALNETRE (10aa)
- AFENVTDLQWLILDHNLLENSK (22aa)
- GSNYTSK (7aa)
- ICNQNSSNPNQR (12aa)
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- INISENYTISISNAR (15aa)
- QNQCFYNSSYLNVQR (15aa)
- QDQCIYNTTYLNVQR (15aa)
- QDQCIYNTTYINVQR (15aa)
- IANNTHQHVFDDIR (14aa)
- ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
- NCSLCADNIEGK (12aa)
- CATPHGDNASIEATFVK (17aa)
- ADGTVNQIEGEATPVNLTEPAK (22aa)
- IAVQFGPGFSWIANFTK (17aa)
- TCDWIPKPNMSASCK (15aa)
- ELPGVCNETMMALWEECKPCLK (22aa)
- ELPGVCNETMMALWEECK (18aa)
- APGWANSSAGSGR (13aa)
- TFYWDFYTNR (10aa)
- FNITETSEAEIHQSFQHIIR (20aa)
- ADTHDEIIEGINFNITEIPEAQIHEGFQEIIR (32aa)
- ADTHDEILEGLNFNLTEIPEAQIHEGFQELLR (32aa)
- DIVEYYNDSNGSHVLQGR (18aa)
- GQALLVNSSQPWEPLQLHVDK (21aa)
- VSLTNVSISDEGR (13aa)
- VCSNDNK (7aa)
- SANASFNIK (9aa)
- QGGVNATQVLIQHLR (15aa)
- SLDLSHNLISDFAWSDLHNLSALQLLK (27aa)
- TQSLLIVNNATNVVIK (16aa)
- NITVCPDGAIFEQK (14aa)
- MLLTFHTDFSNEENGTIMFYK (21aa)
- ALSNISLR (8aa)
- KLHINHNNLTESVGPLPK (18aa)
- LHINHNNLTESVGPLPK (17aa)
- TINQSSDEIQISMGNAMFVK (20aa)
- NVTYRPHCHICFTPR (15aa)
- FGCEIENNR (9aa)
- VMVDLCNSTK (10aa)
- NNSIYVVANIGDK (13aa)
- KNNHTASILDRM (12aa)
- LGCQHHCVPTLDGPTCYCNSSFQLQADGK (29aa)
- QKYELRVDLEDFENNTAYAK (20aa)
- NFTEVEENMSVQGGLSESAPQSNFSYTQPAMENIQVR (37aa)
- IEDINGCPK (9aa)
- VDIEDFENNTAYAK (14aa)
- KEHEGAIYPDNTTDFQRA (18aa)
- KEHEGAIYPDNTTDFQRADDKV (22aa)
- EHEGAIYPDNTTDFQR (16aa)
- NVSVEALASALQLLAR (16aa)
- QQYNALLSNMSR (12aa)
- IISNASCTTNCLAPLAK (17aa)
- YHKNNKSWMESEF (13aa)
- HTNYSFSPWHGFTIHR (16aa)
- TAGWNVPIGTIRPFINWTGPPEPIEAAVAR (30aa)
- VCQDCPIIAPINDTR (15aa)
- KVCQDCPLLAPLNDTRV (17aa)
- RRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (33aa)
- RTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (32aa)
- VCQDCPLLAPLNDTR (15aa)
- IGSFEGIVNITFIHIQHNR (19aa)
- AGPNGTLFVADAYK (14aa)
- VYKPSAGNNSLYR (13aa)
- RVYKPSAGNNSLYRD (15aa)
- VYSSANNCTFE (11aa)
- IYIDHNNITR (10aa)
- GNFSTEGCGCVCEPGWK (17aa)
- HGIQYFNNNTQHSSLFMLNEVK (22aa)
- HGIQYFNNNTQHSSLFTLNEVK (22aa)
- FVACQMELLHSNGSQR (16aa)
- SDNGSYICK (9aa)
- AALAAFNAQNNGSNFQLEEISR (22aa)
- AAPAPQEATATFNSTADR (18aa)
- LSDLSINSTECLHVHCR (17aa)
- DSIMENGTLCYEVHYR (16aa)
- NITGLENFTLK (11aa)
- TPEYYPNAGLIMNYCR (16aa)
- MVSHHNLTTGATLINEQWLLTTAK (24aa)
- EHAVFTSNQEEQDPANHTCGVK (22aa)
- LPPGLLANFTLLR (13aa)
- SWPAVGNCSSALR (13aa)
- NESLETYPVMK (11aa)
- NASNMEYR (8aa)
- LQLDCRPLEGNSTVTGQPR (19aa)
- NCSFSIIYPVVIK (13aa)
- ITYSIVQTNCSK (12aa)
- LNDTLLMCLK (10aa)
- NWCAYVHTR (9aa)
- KLNNLTFLYLDHNALESVPLNLPESLR (27aa)
- TNSTFVQALVEHVK (14aa)
- VVIGANGTYSCIVR (14aa)
- KNVSCYIQNLLLGQEKK (17aa)
- VEMANLLNLSER (12aa)
- CNTAAPMWLNGTHPSSDEGIVSR (23aa)
- NYNENLTLIR (10aa)
- DTFVNASR (8aa)
- VVLHPNYSQVDIGLIK (16aa)
- NISDGFDGIPDNVDAALALPAHSYSGR (27aa)
- FEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGR (39aa)
- HLNGTITAK (9aa)
- GCSSSTSVLLTLDNNVVNGSSPAIR (25aa)
- KDNTTVTR (8aa)
- TTEFDTNSTDIALK (14aa)
- KDFEDIYTPVNGSIVIVR (18aa)
- ISHNEIADSGIPGNSFNVSSIVEIDISYNK (30aa)
- DQNTPVVHPPPTPGSCGHGGVVNISK (26aa)
- IGNWSAMPSCK (11aa)
- VLSNNSDANLELINTWVAK (19aa)
- KLENSLLDHRNKT (13aa)
- IININPNK (8aa)
- IGISFNSISAVDNGSIANTPHIR (23aa)
- GLSFNSISAVDNGSLANTPHLR (22aa)
- QVLDNLTMEK (10aa)
- VIDLWDLAQSANLTDK (16aa)
- MIENGSISFIPTIR (14aa)
- YTGNASALFILPDQDK (16aa)
- YLGNATAIFFLPDEGK (16aa)
- KYTGNASALFILPDQDKM (18aa)
- DMSDEVGCVNVTLCEGPNK (19aa)
- STGNLSTYNCQLLK (14aa)
- VIHNGTIAEIQGIPHIR (17aa)
- LNSSTIK (7aa)
- ERPPTFLTPEGNASNK (16aa)
- YSENSTTVIR (10aa)
- IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
- ITDIENGSIANIPR (14aa)
- SGNNNGSEPSDIIIPLR (17aa)
- MNASFSLK (8aa)
- NVSVAEGK (8aa)
- YTGNPTK (7aa)
- CFLGNGTGYR (10aa)
- LNAENNATFYFK (12aa)
- GFSTQVLLGDVYQSPCTMAQRPQNFNSSAR (30aa)
- NQTHYALQASLK (12aa)
- INAENNATFYFK (12aa)
- GNLTYGYVTILNGSDIR (17aa)
- GYNFSR (6aa)
- YIQVVYLHNNNISVVGSSDFCPPGHNTK (28aa)
- NATGDYK (7aa)
- IIQVVYIHSNNITK (14aa)
- LQVVYLHSNNITK (13aa)
- NETLALPAESK (11aa)
- LWNFTMNAK (9aa)
- NINYTER (7aa)
- SCPACPGSNITIR (13aa)
- VTQVYAENGTVLQGSTVASVYK (22aa)
- VLNFTTK (7aa)
- INGTQICPNDIVAFHDFSSDIENVPHIR (28aa)
- FSIYTALFNNMTSVSK (16aa)
- FFAENETWVVDSCTTCTCK (19aa)
- RFPNIT (6aa)
- IIDNNKTEK (9aa)
- MVNMTK (6aa)
- IHVGNYNGTAGDAIR (15aa)
- LHVGNYNGTAGDALR (15aa)
- LAGKPTHVNVSVVMAEVDGTC (21aa)
- YNATVYSQAANGTEGQPQAIEFR (23aa)
- GEVFNATR (8aa)
- VFNATR (6aa)
- NGSQAFVHWQEPR (13aa)
- VGQLQLSHNLSLVILVPQNLK (21aa)
- QGNNHTCTWK (10aa)
- MINTSSIIEQINEQFNWVSR (20aa)
- NMSNQLGLLAVNQR (14aa)
- NATVVWMK (8aa)
- DASSFIAEWQNITK (14aa)
- MNDTIFGFTMEER (13aa)
- LANLTQGEDQYYLR (14aa)
- IANITQGEDQYYIR (14aa)
- RLANLTQGEDQYYLRV (16aa)
- NLSDVATK (8aa)
- TSMGLPVATLQQLEAAAVNVCNQTWAQLQAR (31aa)
- LVPHMNVSAVEK (12aa)
- HTDDITSINNTIANIR (16aa)
- ANYTILK (7aa)
- TVNSSHYR (8aa)
- ENLTAPGSDSAVFFEQGTTR (20aa)
- GLNLTEDTYKPR (12aa)
- YKGLNLTEDTYKPR (14aa)
- VDIIVANLTVTDK (13aa)
- TMVFPVMYLNESVHIDK (17aa)
- NFTENDLLVR (10aa)
- VFIVPVGNHSNIPFSR (16aa)
- INYTVPQSGTFK (12aa)
- LSLLEEPGNGTFTVILNQLTSR (22aa)
- RLSLLEEPGNGTFTVILNQLTSRD (24aa)
- ENVSMVDYAHNNYQAQSAVPLR (22aa)
- VNESVVSIAAQQK (13aa)
- CGIVPVIAENYNK (13aa)
- HIPGLIHNMTAR (12aa)
- SDFSQTMLFQANTTR (15aa)
- VYSGILNQSEIK (12aa)
- ALPQPQNVTSLLGCTH (16aa)
- APQHVVNHLPPYTNVSLK (18aa)
- LTDTICGVGNMSANASDQER (20aa)
- VPGNVTAVIGETIK (14aa)
- KVPGNVTAVLGETLKV (16aa)
- IIISPEENVTITCTAENQIER (21aa)
- NFTEVHPDYGSHIQALLDK (19aa)
- SAPPSQVWNMTVSMTSDNSMHVK (23aa)
- IFSWMQTNNSSHWTEFLWFIQMSQNQPYHR (30aa)
- ANSTGTLVITDPTR (14aa)
- TAGWNIPMGIIFNQTGSCK (19aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
- YGNPNETQNNSTSWPVFK (18aa)
- LHNQLLPNVTTVER (14aa)
- QNSTMFSLTPENSWTPK (17aa)
- VFGSQNLTTVK (11aa)
- LPTQNITFQTESSVAEQEAEFQSPK (25aa)
- SCSLEGNPVACINLSFCLNASGK (23aa)
- LDFIILNETK (10aa)
- DQCIVDDITYNVNDTFHK (18aa)
- IYPITWNGSICMR (13aa)
- FILNTENNFTLTDNHDNTANITVK (24aa)
- SHGVQTMVVLNNLEPNTTYEIR (22aa)
- IPEDGSLNTTK (11aa)
- DDAGNYTCIASNGPQGQIR (19aa)
- INNLTVSLEMEK (12aa)
- EVNDTLLVNELK (12aa)
- TCPAGVMGENNTLVWK (16aa)
- QQQHLFGSNVTDCSGNFCLFR (21aa)
- QQQHIFGSNVTDCSGNFCIFR (21aa)
- NSSVEAFK (8aa)
- KFGRNGSDCPDKF (13aa)
- TMFPNLTDVR (10aa)
- NNSYECDIPI (10aa)
- NVTLLWK (7aa)
- KDTCTQECSYFNITK (15aa)
- NVSVDSTHPTK (11aa)
- NATITQYQLK (10aa)
- NMQIANHTLK (10aa)
- DQDPASFGADSLLLNSSR (18aa)
- FDVNQLQNTTIK (12aa)
- NDCISAPINSLLQMAK (16aa)
- IETILLNGTDR (11aa)
- ELHHLQEQNVSNAFLDK (17aa)
- KELHHLQEQNVSNAFLDKG (19aa)
- NESVHPFSPFEVK (13aa)
- RPASNVSASIQR (12aa)
- DNIGSQYLLNWCVQIAK (17aa)
- FCNESMGDCGPTGLAQHCHLHAR (23aa)
- LNQSNFQK (8aa)
- LSALDNLLNHSSMFLK (16aa)
- SAIIEFACTHNIGNCSTTAMK (21aa)
- IFDDWMASNGTQSIPTDVMTTVFK (24aa)
- TVGNQTSTK (9aa)
- IPCSQPPQIEHGTINSSR (18aa)
- HLVNISVYAFNK (12aa)
- AYNSAGAGPFSATVNVTTK (19aa)
- ISEENETTCYMGK (13aa)
- DENESPIPCFLAGDHR (16aa)
- DINSQQELQNITTDTR (16aa)
- NVSTTLSTVGAR (12aa)
- TASCSNVTCWIK (12aa)
- ASTEQAPELENLTVTEVGWDGLR (23aa)
- NGTHWFV (7aa)
- TEAGAFEYVPDPTFENFTGGVK (22aa)
- NETHNPTVK (9aa)
- VYCNLSAAHTFEDLK (15aa)
- DLDMFINASK (10aa)
- GTDYINASYIMGYYR (15aa)
- TIAGENQTAFEIEEINR (17aa)
- VEAAQNLTLPGSLR (14aa)
- VEAAQNITIPGSIR (14aa)
- VSNQTLSLFFTVLQDVPVR (19aa)
- IIETVEYNISGAER (14aa)
- WTGHNVTVVQR (11aa)
- NMTALEK (7aa)
- NSTTLVMHMK (10aa)
- SSNVSYK (7aa)
- NLSMK (5aa)
- MEACMLNGTVIGPGK (15aa)
- EAGNITTDGYEIIGK (15aa)
- TAIFAFNISHVSNK (14aa)
- KPNPVMNGSIK (11aa)
- GCHINECLSR (10aa)
- LNLDGSNYTLLK (12aa)
- FVEGSHNSTVSLTTK (15aa)
- ALNLTEGFAVLHWK (14aa)
- TPENYPNAGLTENYCR (16aa)
- ENLCLNLHK (9aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 2735.5035)
- Blood Serum (UBERON_0001977)
-
Alpha-1-acid glycoprotein 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2735.5035)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
-
Erythropoietin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2735.5035)
- Erythropoietin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2735.5035)
- Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
- Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
- Structural study of the N-linked oligosaccharides of hepatocyte growth factor by two-dimensional sugar mapping. (1993 - Hara H, Nakae Y, Sogabe T, Ihara I, Ueno S, Sakai H, Inoue H, Shimizu S, Nakamura T, Shimizu N) / Status : Reviewed
- Carbohydrate structures of a human tissue plasminogen activator variant expressed in recombinant Chinese hamster ovary cells. (1990 - Nimtz M, Noll G, Pques E, Conradt H) / Status : Reviewed
-
Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
- Hepatocyte growth factor / Homo sapiens
-
Tissue-type plasminogen activator / Homo sapiens
- Undefined site
- Salivary plasminogen activator alpha 1 / Desmodus rotundus
-
- N-Linked / Complex
(avg mass : 2735.5035)
- Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
- Structural analysis of the sialylated N- and O-linked carbohydrate chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. Sialylation patterns and branch location of dimeric N-acetyllactosamine units. (1995 - Hokke C, Bergwerff A, Van Dedem G, Kamerling J, Vliegenthart J) / Status : Reviewed
- Primary structure of N-linked carbohydrate chains of a human chimeric plasminogen activator K2tu-PA expressed in Chinese hamster ovary cells. (1993 - Bergwerff A, van Oostrum J, Asselbergs F, Brgi R, Hokke C, Kamerling J, Vliegenthart J) / Status : Reviewed
- Chimeric plasminogen activator K2-tuPA / Homo sapiens
-
Erythropoietin / Homo sapiens
- Undefined site
-
Integrin alpha-5/beta-1 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2735.5035)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Placenta (UBERON_0001987)
- Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
- Structural analysis of the sialylated N- and O-linked carbohydrate chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. Sialylation patterns and branch location of dimeric N-acetyllactosamine units. (1995 - Hokke C, Bergwerff A, Van Dedem G, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structures of sialylated oligosaccharides of human erythropoietin expressed in recombinant BHK-21 cells. (1993 - Nimtz M, Martin W, Wray V, Klppel K, Augustin J, Conradt H) / Status : Reviewed
-
Erythropoietin / Homo sapiens
- Undefined site
-
Integrin alpha-5/beta-1 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2735.5035)
- Blood Plasma (UBERON_0001969)
- Esophageal cancer (DOID:5041)
- Computational framework for identification of intact glycopeptides in complex samples (2014 - Mayampurath A, Yu CY, Song E, Balan J, Mechref Y, Tang H.) / Status : Reviewed
- Exploring site-specific N-glycosylation microheterogeneity of haptoglobin using glycopeptide CID tandem mass spectra and glycan database search (2013 - Chandler KB1, Pompach P, Goldman R, Edwards N.) / Status : Reviewed
- Alpha-2-macroglobulin / Homo sapiens
- Haptoglobin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2735.5035)
- Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
- Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
- Elucidation of N-linked oligosaccharide structures of recombinant human factor VIII using fluorophore-assisted carbohydrate electrophoresis. (1996 - Kumar H, Hague C, Haley T, Starr C, Besman M, Lundblad R, Baker D) / Status : Reviewed
- Structural study of the N-linked oligosaccharides of hepatocyte growth factor by two-dimensional sugar mapping. (1993 - Hara H, Nakae Y, Sogabe T, Ihara I, Ueno S, Sakai H, Inoue H, Shimizu S, Nakamura T, Shimizu N) / Status : Reviewed
-
Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
-
Coagulation factor VIII / Homo sapiens
- Undefined site
- Hepatocyte growth factor / Homo sapiens
- Salivary plasminogen activator alpha 1 / Desmodus rotundus
-
- N-Linked / Complex
(avg mass : 2735.5035)
-
Tissue-type plasminogen activator / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2735.5035)
- Blood Plasma (UBERON_0001969)
- In-depth analysis of site-specific N-glycosylation in vitronectin from human plasma by tandem mass spectrometry with immunoprecipitation (2014 - Hwang H, Lee JY, Lee HK, Park GW, Jeong HK, Moon MH, Kim JY, Yoo JS.) / Status : Reviewed
- Site-specific N-glycosylation analysis of human factor XI: Identification of a noncanonical NXC glycosite (2014 - Faid V, Denguir N, Chapuis V, Bihoreau N, Chevreux G) / Status : Reviewed
- Coagulation factor XI / Homo sapiens
- Vitronectin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2735.5035)
-
Neuroligin 1 / Rattus norvegicus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2735.5035)
- Structural analysis of the sialylated N- and O-linked carbohydrate chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. Sialylation patterns and branch location of dimeric N-acetyllactosamine units. (1995 - Hokke C, Bergwerff A, Van Dedem G, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structures of sialylated oligosaccharides of human erythropoietin expressed in recombinant BHK-21 cells. (1993 - Nimtz M, Martin W, Wray V, Klppel K, Augustin J, Conradt H) / Status : Reviewed
-
Erythropoietin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2735.5035)
- Structural analysis of the sialylated N- and O-linked carbohydrate chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. Sialylation patterns and branch location of dimeric N-acetyllactosamine units. (1995 - Hokke C, Bergwerff A, Van Dedem G, Kamerling J, Vliegenthart J) / Status : Reviewed
- Primary structure of N-linked carbohydrate chains of a human chimeric plasminogen activator K2tu-PA expressed in Chinese hamster ovary cells. (1993 - Bergwerff A, van Oostrum J, Asselbergs F, Brgi R, Hokke C, Kamerling J, Vliegenthart J) / Status : Reviewed
- Chimeric plasminogen activator K2-tuPA / Homo sapiens
-
Erythropoietin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2735.5035)
- Eveline (CVCL_A1LI)
- Envelope glycoprotein / Friend murine leukemia virus
-
- N-Linked / Complex
(avg mass : 2735.5035)
- Eveline (CVCL_A1LI)
- Envelope glycoprotein / Friend murine leukemia virus
-
- N-Linked / Complex
(avg mass : 2735.5035)
-
Glycocalicin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2735.5035)
- Thyroid (UBERON_0002046)
-
Thyroglobulin / Sus scrofa
- Undefined site
-
- N-Linked / Complex
(avg mass : 2735.5035)
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
- Immunoglobulin epsilon chain c region / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2735.5035)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Metalloproteinase inhibitor 1 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2735.5035)
- The Asn-linked carbohydrate chains of human Tamm-Horsfall glycoprotein of one male. Novel sulfated and novel N-acetylgalactosamine-containing N-linked carbohydrate chains. (1992 - Hard K, Van Zadelhoff G, Moonen P, Kamerling J, Vliegenthart F) / Status : Reviewed
- Identification of a tetrasialylated monofucosylated tetraantennary N-linked carbohydrate chain in human platelet glycocalicin. (1988 - Korrel S, Clemetson K, van Halbeek H, Kamerling J, Sixma J, Vliegenthart J) / Status : Reviewed
-
Glycocalicin / Homo sapiens
- Undefined site
-
Uromodulin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2735.5035)
- Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
- Structural analysis of the sialylated N- and O-linked carbohydrate chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. Sialylation patterns and branch location of dimeric N-acetyllactosamine units. (1995 - Hokke C, Bergwerff A, Van Dedem G, Kamerling J, Vliegenthart J) / Status : Reviewed
-
Erythropoietin / Homo sapiens
- Undefined site
-
Integrin alpha-5/beta-1 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2735.5035)
-
Thrombopoietin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2735.5035)
- Blood Plasma (UBERON_0001969)
-
Ceruloplasmin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2735.5035)
-
Glycocalicin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2735.5035)
- Eveline (CVCL_A1LI)
- Envelope glycoprotein / Friend murine leukemia virus
-
- N-Linked / Complex
(avg mass : 2735.5035)
- Blood Serum (UBERON_0001977)
- Haptoglobin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2735.5035)
- Amniotic Fluid (UBERON_0000173)
- Fetal antigen 1 / Mus musculus
-
- N-Linked / Complex
(avg mass : 2735.5035)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Erythropoietin / Homo sapiens
- EAENITTGC (9aa)
- SLNENITVPDTK (12aa)
- GQALLVNSSQPWEPLQLHVDK (21aa)
-
- N-Linked / Complex
(avg mass : 2735.5035)
- Milk (UBERON_0001913)
- Alpha-1-acid glycoprotein 1 / Homo sapiens
- Alpha-1-antichymotrypsin / Homo sapiens
- Alpha-2-HS-glycoprotein / Homo sapiens
- Alpha-S1-casein / Homo sapiens
- Beta-2-glycoprotein 1 / Homo sapiens
- Butyrophilin subfamily 1 member A1 / Homo sapiens
- Carbonic anhydrase 6 / Homo sapiens
- CD59 glycoprotein / Homo sapiens
- CD63 antigen / Homo sapiens
- Ceruloplasmin / Homo sapiens
- Clusterin / Homo sapiens
- Lactotransferrin / Homo sapiens
- Lipoprotein lipase / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Vitronectin / Homo sapiens
- KTAVNCSSDFDACLITKA (18aa)
- KWFYIASAFRNEEYNKS (17aa)
- KDTRNESTQNCVVAEPEKM (19aa)
- RTPEDTAEDTCHLIPGVAESVATCHFNHSSKT (32aa)
- KEDALNETRESETKL (15aa)
- KNNATVHEQVGGPSLTSDLQAQSKG (25aa)
- KKKEDALNETRE (12aa)
- KKKEDALNETRESETKL (17aa)
- KEDALNETRE (10aa)
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- KNNHTASILDRM (12aa)
- KEHEGAIYPDNTTDFQRADDKV (22aa)
- KEHEGAIYPDNTTDFQRA (18aa)
- RTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (32aa)
- KVCQDCPLLAPLNDTRV (17aa)
- RRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (33aa)
- RVYKPSAGNNSLYRD (15aa)
- KNVSCYIQNLLLGQEKK (17aa)
- KLENSLLDHRNKT (13aa)
- KYTGNASALFILPDQDKM (18aa)
- RLANLTQGEDQYYLRV (16aa)
- RLSLLEEPGNGTFTVILNQLTSRD (24aa)
- KVPGNVTAVLGETLKV (16aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
- KFGRNGSDCPDKF (13aa)
- KELHHLQEQNVSNAFLDKG (19aa)
-
- N-Linked / Complex
(avg mass : 2735.5035)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena DomÃnguez-Vega) / Status : Reviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- GEVFNATR (8aa)
-
- N-Linked / Complex
(avg mass : 2735.5035)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
-
- N-Linked / Complex
(avg mass : 2735.5035)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- VYSSANNCTFE (11aa)
- VFNATR (6aa)
-
- N-Linked / Complex
(avg mass : 2735.5035)
- HEK293T (CVCL_0063)
- Immunoglobulin epsilon chain c region / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2735.5035)
- Bone Marrow (UBERON_0002371)
-
- N-Linked / Complex
(avg mass : 2735.5035)
- Urine (UBERON_0001088)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 2735.5035)
- Blood Serum (UBERON_0001977)
- Control/Healthy
- Familial hepatic adenoma (DOID:111366)
- Maturity-onset diabetes of the young type 3 (DOID:0111102)
-
Alpha-1-acid glycoprotein 1 / Homo sapiens
- Undefined site
-
Alpha-1-antitrypsin / Homo sapiens
- Undefined site
-
Serotransferrin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2735.5035)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2735.5035)
- Blood Plasma (UBERON_0001969)
-
Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2735.5035)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2735.5035)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- NKSVLLGR (8aa)
-
- Hex:6 HexNAc:5 dHex:1 NeuAc:2 / N-Linked
(avg mass : 2735.5035)
- Blood Serum (UBERON_0001977)
- Colon (UBERON_0001155)
- Liver (UBERON_0002107)
- Mammary Gland (UBERON_0001911)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- LS174T (CVCL_1384)
- N-Linked / Complex / Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Fuc + 2 x NeuAc(a2-?)"
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 867
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x NeuAc(a2-3)"
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 2575
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x NeuAc(a2-3)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-3) + NeuAc(a2-6)"
- N-Linked / Complex / Structure 1814
- N-Linked / Complex / Hex(?1-?)HexNAc(?1-?)Man(a1-?)[Hex(?1-?)HexNAc(?1-?)[Hex(?1-?)HexNAc(?1-?)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ 2 x NeuAc"
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-3)"
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-?)"
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-6)"
- N-Linked / Complex / Structure 1712
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ 2 x NeuAc(a2-6)"
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-3)"
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)[Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-3)"
- N-Linked / Complex / Structure 2121
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-?)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-?)Gal(b1-?)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc+"+ Hex + HexNAc"
- N-Linked / Complex / Structure 9324
- N-Linked / Complex / Structure 9451
- N-Linked / Complex / Structure 9840
- N-Linked / Complex / Structure 9851
- N-Linked / Complex / Structure 10040
- N-Linked / Complex / Structure 10232
- N-Linked / Complex / Structure 10595
- N-Linked / Complex / Structure 10690
- N-Linked / Complex / Structure 10752
- N-Linked / Complex / Structure 10888
- N-Linked / Complex / Structure 10897
- N-Linked / Complex / Structure 10913
- N-Linked / Complex / Structure 10973
- Cancer, breast (DOID:1612)
- Colon adenocarcinoma (DOID:234)
- COVID-19 (DOID:0080600)
- Gastritis (DOID:4029)
- Prostate cancer (DOID:10283)
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- 4F2 cell-surface antigen heavy chain / Homo sapiens
- ADAM DEC1 / Homo sapiens
- Adenosine deaminase 2 / Homo sapiens
- Adhesion G protein-coupled receptor F5 / Homo sapiens
- Adhesion G protein-coupled receptor L4 / Homo sapiens
- Adhesion G-protein coupled receptor D1 / Homo sapiens
- Adipocyte enhancer-binding protein 1 / Homo sapiens
- Adipocyte plasma membrane-associated protein / Homo sapiens
- Alkaline phosphatase, tissue-nonspecific isozyme / Homo sapiens
- Alpha-1-acid glycoprotein 1 / Homo sapiens
- Alpha-1-acid glycoprotein 2 / Homo sapiens
- Alpha-1-antichymotrypsin / Homo sapiens
- Alpha-1-antitrypsin / Homo sapiens
- Alpha-2-HS-glycoprotein / Homo sapiens
- Alpha-2-macroglobulin / Homo sapiens
- Alpha-2-macroglobulin receptor-associated protein / Homo sapiens
- Angiopoietin-1 receptor / Homo sapiens
- Angiotensin-converting enzyme / Homo sapiens
- Apolipoprotein (a) / Homo sapiens
- Apolipoprotein B-100 / Homo sapiens
- Apolipoprotein D / Homo sapiens
- Apolipoprotein F / Homo sapiens
- Asialoglycoprotein receptor 2 / Homo sapiens
- Asporin / Homo sapiens
- Attractin / Homo sapiens
- Beta-2-glycoprotein 1 / Homo sapiens
- Beta-Ala-His dipeptidase / Homo sapiens
- Biglycan / Homo sapiens
- Cadherin-2 / Homo sapiens
- Cadherin-5 / Homo sapiens
- Carboxypeptidase b2 / Homo sapiens
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Catalase / Homo sapiens
- Cation-independent mannose-6-phosphate receptor / Homo sapiens
- CD109 antigen / Homo sapiens
- CD166 antigen / Homo sapiens
- CD276 antigen / Homo sapiens
- CD44 antigen / Homo sapiens
- CD59 glycoprotein / Homo sapiens
- Cell adhesion molecule 1 / Homo sapiens
- Ceruloplasmin / Homo sapiens
- Cholinesterase / Homo sapiens
- Clusterin / Homo sapiens
- Coagulation factor XI / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collectin-12 / Homo sapiens
- Complement c1r subcomponent / Homo sapiens
- Complement C2 / Homo sapiens
- Complement component c6 / Homo sapiens
- Complement factor h / Homo sapiens
- Complement factor i / Homo sapiens
- Contactin-1 / Homo sapiens
- Contactin-3 / Homo sapiens
- Contactin-4 / Homo sapiens
- Corticotropin-releasing factor-binding protein / Homo sapiens
- Decorin / Homo sapiens
- Desmocollin-2 / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Dipeptidyl peptidase 4 / Homo sapiens
- Ecto-ADP-ribosyltransferase 4 / Homo sapiens
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 / Homo sapiens
- Ectopic P granules protein 5 homolog / Homo sapiens
- Endoplasmic reticulum aminopeptidase 2 / Homo sapiens
- Endothelin-converting enzyme 1 / Homo sapiens
- Ephrin-B2 / Homo sapiens
- Epidermal growth factor receptor / Homo sapiens
- Epithelial cell adhesion molecule / Homo sapiens
- Extracellular matrix protein 1 / Homo sapiens
- Extracellular serine/threonine protein kinase FAM20C / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibroleukin / Homo sapiens
- Fibromodulin / Homo sapiens
- Fibronectin / Homo sapiens
- Fibulin-1 / Homo sapiens
- G-protein coupled receptor 126 / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Gamma-glutamyltranspeptidase 1 / Homo sapiens
- Gliomedin [Cleaved into: Gliomedin shedded ectodomain] / Homo sapiens
- Glyceraldehyde-3-phosphate dehydrogenase / Homo sapiens
- Haptoglobin / Homo sapiens
- Hemopexin / Homo sapiens
- Heparin cofactor 2 / Homo sapiens
- Hepatocyte growth factor activator / Homo sapiens
- Hepatocyte growth factor receptor / Homo sapiens
- HLA class II histocompatibility antigen, DRB1-1 beta chain / Homo sapiens
- HLA class II histocompatibility antigen, DRB1-10 beta chain / Homo sapiens
- HLA class II histocompatibility antigen, DRB1-9 beta chain / Homo sapiens
- Homeobox protein Hox-B3 / Homo sapiens
- Hypoxia up-regulated protein 1 / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
Source
Suggested structure
Disease
Reference
Reported glycosite
- Hex:6 HexNAc:5 dHex:1 NeuAc:2 / N-Linked
(avg mass : 2735.5035)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2735.5035)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2735.5035)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2735.5035)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2735.5035)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2735.5035)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2735.5035)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2735.5035)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2735.5035)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2735.5035)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2735.5035)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2735.5035)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2735.5035)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2735.5035)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2735.5035)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2735.5035)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2735.5035)
Reported glycosite
- N-Linked / Complex
(avg mass : 2735.5035)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2735.5035)
Reported glycosite
- N-Linked / Complex
(avg mass : 2735.5035)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2735.5035)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2735.5035)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2735.5035)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2735.5035)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2735.5035)
Reported glycosite
- N-Linked / Complex
(avg mass : 2735.5035)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2735.5035)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2735.5035)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2735.5035)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2735.5035)
Reported glycosite
- N-Linked / Complex
(avg mass : 2735.5035)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2735.5035)
Reported glycosite
- N-Linked / Complex
(avg mass : 2735.5035)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2735.5035)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2735.5035)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2735.5035)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2735.5035)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2735.5035)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2735.5035)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2735.5035)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2735.5035)