Hex:5 HexNAc:6 dHex:1 NeuAc:1

Taxonomy

• Homo sapiens (Human)
• Mus musculus (House mouse)
• Ovis aries (Sheep)
• Rattus norvegicus (Norway rat)
• Human immunodeficiency virus type 1 (HIV-1)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Homo sapiens    Q16880
• Angiotensin-converting enzyme 2 / Homo sapiens    Q9BYF1
• Aspartyl/asparaginyl beta-hydroxylase / Homo sapiens    Q12797
• Asporin / Homo sapiens    Q9BXN1
• Biglycan / Homo sapiens    P21810
• CD59 glycoprotein / Homo sapiens    P13987
• Clusterin / Homo sapiens    P10909
• Coagulation factor XIII B chain / Homo sapiens    P05160
• Complement factor H-related protein 5 / Homo sapiens    Q9BXR6
• Decorin / Homo sapiens    P07585
• Dipeptidyl peptidase 1 / Homo sapiens    P53634
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens    P04844
• Fibromodulin / Homo sapiens    Q06828
• Fibronectin / Homo sapiens    P02751
• Heparin cofactor 2 / Homo sapiens    P05546
• Immunoglobulin epsilon chain c region / Homo sapiens    P01854
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Interleukin-1 receptor accessory protein / Homo sapiens    Q9NPH3
• Leucine-rich alpha-2-glycoprotein / Homo sapiens    P02750
• Lumican / Homo sapiens    P51884
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Mannan-binding lectin serine protease 1 / Homo sapiens    P48740
• Methylated-DNA--protein-cysteine methyltransferase / Homo sapiens    P16455
• NADPH--cytochrome P450 reductase / Homo sapiens    P16435
• Olfactomedin-like protein 3 / Homo sapiens    Q9NRN5
• Phosphatidylinositol-glycan-specific phospholipase D / Homo sapiens    P80108
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens    Q07954
• Prostaglandin F2 receptor negative regulator / Homo sapiens    Q9P2B2
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens    P07288
• Protein AMBP / Homo sapiens    P02760
• Prothrombin / Homo sapiens    P00734
• Secretogranin-3 / Homo sapiens    Q8WXD2
• Serum paraoxonase/arylesterase 1 / Homo sapiens    P27169
• Translocon-associated protein subunit alpha / Homo sapiens    P43307
• Type 2 lactosamine alpha-2,3-sialyltransferase / Homo sapiens    Q9Y274
• Vitronectin / Homo sapiens    P04004
• Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries    Q712V9
• Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries    Q712V9
• Neuroligin 1 / Rattus norvegicus    Q62765
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Brain (UBERON_0000955)  
• Cerebellum (UBERON_0002037)  
• Frontal Cortex (UBERON_0001870)  
• Hippocampul formation (UBERON:0002421)  
• Kidney (UBERON_0002113)   HEK293 (CVCL_0045)  
• Kidney (UBERON_0002113)   HEK293-EBNA (CVCL_6974)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Prefrontal Cortex (UBERON:0000451)  
• Seminal Fluid (UBERON_0006530)  
• Striatum (UBERON_0002345)  
• Urine (UBERON_0001088)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• HEK293SF-3F6 (CVCL_4V95)  
• HEK293T (CVCL_0063)  

Reported structure

• N-Linked / Complex / Structure 2458
• N-Linked / Complex / Structure 9529
• N-Linked / Complex / Structure 9927
• N-Linked / Complex / Structure 10225
• N-Linked / Complex / Structure 10969
• N-Linked / Complex / Structure 11695
• N-Linked / Complex / Structure 11776
• N-Linked / Complex / Structure 11793
• N-Linked / Complex / Structure 11927
• N-Linked / Undefined core / HexNAc(?1-?)Man(a1-?)[HexNAc(?1-?)[HexNAc (?1-?)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ (2 x Hex) + HexNAc + NeuAc"

Composition

• Hex:5 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2485.2982 )

Disease

• Cancer, breast (DOID:1612)
• COVID-19 (DOID:0080600)
• Prostate cancer (DOID:10283)
• Scrapie (DOID:5434)

Reference

• Mammalian brain glycoproteins exhibit diminished glycan complexity compared to other tissues (2022 - Williams SE, Noel M, Lehoux S, Cetinbas M, Xavier RJ, Sadreyev RI, Scolnick EM, Smoller JW, Cummings RD, Mealer RG) / Status : Reviewed
• Differential N- and O-glycosylation signatures of HIV-1 Gag virus-like particles and coproduced extracellular vesicles (2022 - Lavado-García J, Zhang T, Cervera L, Gòdia F, Wuhrer M) / Status : Reviewed
• Site-specific analysis of N-glycans from different sheep prion strains (2021 - Natali Nakić ,Thanh Hoa Tran ,Mislav Novokmet,Olivier Andreoletti,Gordan Lauc,Giuseppe Legname) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
• Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Spatial and temporal diversity of glycome expression in mammalian brain (2020 - Lee J, Ha S, Kim M, Kim SW, Yun J, Ozcan S, Hwang H, Ji IJ, Yin D, Webster MJ, Shannon Weickert C, Kim JH, Yoo JS, Grimm R, Bahn S, Shin HS, An HJ) / Status : Reviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
• Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
• Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
• Structural characterization of recombinant soluble rat neuroligin 1: mapping of secondary structure and glycosylation by mass spectrometry. (2004 - Hoffman RC, Jennings LL, Tsigelny I, Comoletti D, Flynn RE, Sudhof TC, Taylor P) / Status : Reviewed

Reported glycosite

• 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Homo sapiens
  •        Asn-333
• Angiotensin-converting enzyme 2 / Homo sapiens
  •        Undefined site
• Aspartyl/asparaginyl beta-hydroxylase / Homo sapiens
  •        Asn-452
• Asporin / Homo sapiens
  •        Asn-282
• Biglycan / Homo sapiens
  •        Asn-270
  •        Asn-311
• CD59 glycoprotein / Homo sapiens
  •        Asn-43
• Clusterin / Homo sapiens
  •        Asn-86
  •        Asn-103
  •        Asn-354
  •        Asn-374
• Coagulation factor XIII B chain / Homo sapiens
  •        Asn-545
• Complement factor H-related protein 5 / Homo sapiens
  •        Asn-126
• Decorin / Homo sapiens
  •        Asn-262
• Dipeptidyl peptidase 1 / Homo sapiens
  •        Asn-119
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
  •        Asn-106
• Fibromodulin / Homo sapiens
  •        Asn-201
  •        Asn-291
• Fibronectin / Homo sapiens
  •        Asn-430
  •        Asn-528
  •        Asn-542
• Heparin cofactor 2 / Homo sapiens
  •        Asn-188
• Immunoglobulin epsilon chain c region / Homo sapiens
  •        Asn-21
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-517
  •        Asn-577
• Interleukin-1 receptor accessory protein / Homo sapiens
  •        Asn-118
• Leucine-rich alpha-2-glycoprotein / Homo sapiens
  •        Asn-325
• Lumican / Homo sapiens
  •        Asn-88
  •        Asn-127
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-84
• Mannan-binding lectin serine protease 1 / Homo sapiens
  •        Asn-178
• Methylated-DNA--protein-cysteine methyltransferase / Homo sapiens
  •        Asn-157
• NADPH--cytochrome P450 reductase / Homo sapiens
  •        Asn-175
• Olfactomedin-like protein 3 / Homo sapiens
  •        Asn-248
• Phosphatidylinositol-glycan-specific phospholipase D / Homo sapiens
  •        Asn-321
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-90
  •        Asn-499
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
  •        Asn-3839
• Prostaglandin F2 receptor negative regulator / Homo sapiens
  •        Asn-286
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-78
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
  •        Asn-69
• Protein AMBP / Homo sapiens
  •        Asn-250
• Prothrombin / Homo sapiens
  •        Asn-416
• Secretogranin-3 / Homo sapiens
  •        Asn-346
• Serum paraoxonase/arylesterase 1 / Homo sapiens
  •        Asn-253
• Translocon-associated protein subunit alpha / Homo sapiens
  •        Asn-136
• Type 2 lactosamine alpha-2,3-sialyltransferase / Homo sapiens
  •        Asn-308
• Vitronectin / Homo sapiens
  •        Asn-169
• Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries
  •        Asn-184
• Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries
  •        Asn-184
• Neuroligin 1 / Rattus norvegicus
  •        Undefined site
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-17
  •        Asn-74
  •        Asn-149
  •        Asn-331
  •        Asn-343
  •        Asn-1074
  •        Asn-1098
  •        Asn-1194
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-282
  •        Asn-1074

Mass spectrometry observed peptide

• QCVNLTTR (8aa)
  •    P0DTC2    Asn-17     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• TAVNCSSDFDACLITK (16aa)
  •    P13987    Asn-43     CD59 glycoprotein / Homo sapiens
• NKSVLLGR (8aa)
  •    P07288    Asn-69     Prostate-specific antigen (psa-1) / Homo sapiens
  •    P07288    Asn-69     Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
• FHAIHVSGTNGTKRF (15aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• SVVAPATDGGLNLTSTFLRK (20aa)
  •    P41222    Asn-78     Prostaglandin-h2 d-isomerase / Homo sapiens
• SVVAPATDGGLNLTSTFLR (19aa)
  •    P41222    Asn-78     Prostaglandin-h2 d-isomerase / Homo sapiens
• SSCGKENTSDPSIVIAFGR (19aa)
  •    P11279    Asn-84     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• KEDALNETR (9aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• AFENVTDLQWLILDHNLLENSK (22aa)
  •    P51884    Asn-88     Lumican / Homo sapiens
• RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
  •    P01833    Asn-90     Polymeric immunoglobulin receptor / Homo sapiens
• ELPGVCNETMMALWEECKPCLK (22aa)
  •    P10909    Asn-103     Clusterin / Homo sapiens
• ISISNETK (8aa)
  •    P04844    Asn-106     Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
• NTTYCSK (7aa)
  •    Q9NPH3    Asn-118     Interleukin-1 receptor accessory protein / Homo sapiens
• VTTYCNETMTGWVHDVIGR (19aa)
  •    P53634    Asn-119     Dipeptidyl peptidase 1 / Homo sapiens
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• KNISCVER (8aa)
  •    Q9BXR6    Asn-126     Complement factor H-related protein 5 / Homo sapiens
• KLHINHNNLTESVGPLPK (18aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• LHINHNNLTESVGPLPK (17aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• FYIQNFTALPLNTVVPPQR (19aa)
  •    P43307    Asn-136     Translocon-associated protein subunit alpha / Homo sapiens
• YHKNNKSWMESEF (13aa)
  •    P0DTC2    Asn-149     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NYSGGLAVK (9aa)
  •    P16455    Asn-157     Methylated-DNA--protein-cysteine methyltransferase / Homo sapiens
• NGSLFAFR (8aa)
  •    P04004    Asn-169     Vitronectin / Homo sapiens
• VFGLGNK (7aa)
  •    P16435    Asn-175     NADPH--cytochrome P450 reductase / Homo sapiens
• FGYILHTDNR (10aa)
  •    P48740    Asn-178     Mannan-binding lectin serine protease 1 / Homo sapiens
• YPNQVYYRPVDQYSNQNNFVHDCVNITVK (29aa)
  •    Q712V9    Asn-184     Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries
  •    Q712V9    Asn-184     Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries
• DFVNASSK (8aa)
  •    P05546    Asn-188     Heparin cofactor 2 / Homo sapiens
• VPNNAIEGIENITAIYIQHNEIQEVGSSMR (30aa)
  •    Q06828    Asn-201     Fibromodulin / Homo sapiens
• FHLANR (6aa)
  •    Q9NRN5    Asn-248     Olfactomedin-like protein 3 / Homo sapiens
• YFYNGTSMACETFQYGGCMGNGNNFVTEK (29aa)
  •    P02760    Asn-250     Protein AMBP / Homo sapiens
• HANWTITPIK (10aa)
  •    P27169    Asn-253     Serum paraoxonase/arylesterase 1 / Homo sapiens
• IGISFNSISAVDNGSIANTPHIR (23aa)
  •    P07585    Asn-262     Decorin / Homo sapiens
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270     Biglycan / Homo sapiens
• NGTITDAVDCALDPLSE (17aa)
  •    P0DTC2    Asn-282     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• ITDIENGSIANIPR (14aa)
  •    Q9BXN1    Asn-282     Asporin / Homo sapiens
• NVSVAEGK (8aa)
  •    Q9P2B2    Asn-286     Prostaglandin F2 receptor negative regulator / Homo sapiens
• LSHNSLTNNGLASNTFNSSSLLELDLSYNQLQK (33aa)
  •    Q06828    Asn-291     Fibromodulin / Homo sapiens
• NVTAEQLFLK (10aa)
  •    Q9Y274    Asn-308     Type 2 lactosamine alpha-2,3-sialyltransferase / Homo sapiens
• IIQVVYIHSNNITK (14aa)
  •    P21810    Asn-311     Biglycan / Homo sapiens
• NINYTER (7aa)
  •    P80108    Asn-321     Phosphatidylinositol-glycan-specific phospholipase D / Homo sapiens
• MFSQNDTR (8aa)
  •    P02750    Asn-325     Leucine-rich alpha-2-glycoprotein / Homo sapiens
• RFPNIT (6aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NLGNNTK (7aa)
  •    Q16880    Asn-333     2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Homo sapiens
• NATRF (5aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NATDNISK (8aa)
  •    Q8WXD2    Asn-346     Secretogranin-3 / Homo sapiens
• MINTSSIIEQINEQFNWVSR (20aa)
  •    P10909    Asn-354     Clusterin / Homo sapiens
• IANITQGEDQYYIR (14aa)
  •    P10909    Asn-374     Clusterin / Homo sapiens
• NFTENDLLVR (10aa)
  •    P00734    Asn-416     Prothrombin / Homo sapiens
• NYTDCTSEGR (10aa)
  •    P02751    Asn-430     Fibronectin / Homo sapiens
• QLFPNDTSLK (10aa)
  •    Q12797    Asn-452     Aspartyl/asparaginyl beta-hydroxylase / Homo sapiens
• KWNNTGCQALPSQDEGPSKA (20aa)
  •    P01833    Asn-499     Polymeric immunoglobulin receptor / Homo sapiens
• DQCIVDDITYNVNDTFHK (18aa)
  •    P02751    Asn-528     Fibronectin / Homo sapiens
• RHEEGHMINCTCFGQGR (17aa)
  •    P02751    Asn-542     Fibronectin / Homo sapiens
• HEEGHMLNCTCFGQGR (16aa)
  •    P02751    Asn-542     Fibronectin / Homo sapiens
• TYENGSSVEYR (11aa)
  •    P05160    Asn-545     Coagulation factor XIII B chain / Homo sapiens
• VPAQEKNF (8aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VPAQEKNFTTAPAICHDGK (19aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VPAQEKNFTTAPAICHDGKAHFPREGVF (28aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• KNLN (4aa)
  •    P0DTC2    Asn-1194     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FGTCSQICNNTK (12aa)
  •    Q07954    Asn-3839     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens