Hex:6 HexNAc:5 NeuAc:1

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Canis lupus familiaris (Dog)
• Mus musculus (House mouse)
• Ovis aries (Sheep)
• Gallus gallus (Chicken)
• Torpedo californica (Pacific electric ray)
• Friend murine leukemia virus (F-mulv)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• 4F2 cell-surface antigen heavy chain / Homo sapiens    P08195
• ADAM DEC1 / Homo sapiens    O15204
• Adenosine deaminase 2 / Homo sapiens    Q9NZK5
• Adhesion G protein-coupled receptor F5 / Homo sapiens    Q8IZF2
• Alpha-1-acid glycoprotein 1 / Homo sapiens    P02763
• Alpha-1-acid glycoprotein 2 / Homo sapiens    P19652
• Alpha-1-antichymotrypsin / Homo sapiens    P01011
• Alpha-1-antitrypsin / Homo sapiens    P01009
• Alpha-2-HS-glycoprotein / Homo sapiens    P02765
• Aminopeptidase n / Homo sapiens    P15144
• Angiotensin-converting enzyme / Homo sapiens    P12821
• Angiotensin-converting enzyme 2 / Homo sapiens    Q9BYF1
• Angiotensinogen / Homo sapiens    P01019
• Apolipoprotein (a) / Homo sapiens    P08519
• Apolipoprotein B-100 / Homo sapiens    P04114
• Apolipoprotein D / Homo sapiens    P05090
• Attractin / Homo sapiens    O75882
• Beta-2-glycoprotein 1 / Homo sapiens    P02749
• Biglycan / Homo sapiens    P21810
• Butyrophilin subfamily 1 member A1 / Homo sapiens    Q13410
• Carboxypeptidase N subunit 2 / Homo sapiens    P22792
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens    P06731
• Catalase / Homo sapiens    P04040
• CD109 antigen / Homo sapiens    Q6YHK3
• CD16A-NK08-V/F genotype / Homo sapiens    P08637
• CD16A-NK09-V/F genotype / Homo sapiens    P08637
• CD16A-NK11-F/F genotype / Homo sapiens    P08637
• CD16A-NK12-V/F genotype / Homo sapiens    P08637
• CD16A-NK13-V/F genotype / Homo sapiens    P08637
• CD276 antigen / Homo sapiens    Q5ZPR3
• CD44 antigen / Homo sapiens    P16070
• CD59 glycoprotein / Homo sapiens    P13987
• Ceruloplasmin / Homo sapiens    P00450
• Cholesteryl ester transfer protein / Homo sapiens    P11597
• Clusterin / Homo sapiens    P10909
• Coagulation factor VIII / Homo sapiens    P00451
• Coagulation factor x / Homo sapiens    P00742
• Collagen alpha-2(VI) chain / Homo sapiens    P12110
• Collagen alpha-3(VI) chain / Homo sapiens    P12111
• Complement c1r subcomponent / Homo sapiens    P00736
• Complement factor h / Homo sapiens    P08603
• Contactin-4 / Homo sapiens    Q8IWV2
• Corticosteroid-binding globulin / Homo sapiens    P08185
• Decorin / Homo sapiens    P07585
• Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens    P78536
• Ecto-ADP-ribosyltransferase 4 / Homo sapiens    Q93070
• Endoplasmic reticulum aminopeptidase 2 / Homo sapiens    Q6P179
• Endothelial cell-selective adhesion molecule / Homo sapiens    Q96AP7
• Ephrin-B2 / Homo sapiens    P52799
• Epidermal growth factor receptor / Homo sapiens    P00533
• Epithelial cell adhesion molecule / Homo sapiens    P16422
• Fibrillin-1 / Homo sapiens    P35555
• Fibroblast growth factor receptor 1 / Homo sapiens    P11362
• Fibroleukin / Homo sapiens    Q14314
• Fibromodulin / Homo sapiens    Q06828
• Fibronectin / Homo sapiens    P02751
• Filamin-B / Homo sapiens    O75369
• Folate receptor alpha / Homo sapiens    P15328
• Galectin-3-binding protein / Homo sapiens    Q08380
• Gamma-glutamyltransferase light chain 1 / Homo sapiens    Q9BX51
• Gamma-glutamyltransferase light chain 2 / Homo sapiens    Q14390
• Gamma-glutamyltranspeptidase 1 / Homo sapiens    P19440
• Haptoglobin / Homo sapiens    P00738
• Hemopexin / Homo sapiens    P02790
• Hepatocyte growth factor receptor / Homo sapiens    P08581
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 2 / Homo sapiens    P01877
• Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens    P01854
• Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens    P01854
• Immunoglobulin heavy constant gamma 4 / Homo sapiens    P01861
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Integrin alpha-2 / Homo sapiens    P17301
• Integrin alpha-X / Homo sapiens    P20702
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Interferon alpha/beta receptor 2 / Homo sapiens    P48551
• Interleukin-6 receptor subunit beta / Homo sapiens    P40189
• Kinesin-1 heavy chain / Homo sapiens    P33176
• Kininogen-1 / Homo sapiens    P01042
• Lactotransferrin / Homo sapiens    P02788
• Laminin subunit alpha-2 / Homo sapiens    P24043
• Laminin subunit alpha-4 / Homo sapiens    Q16363
• Laminin subunit gamma-1 / Homo sapiens    P11047
• Leucine-rich alpha-2-glycoprotein / Homo sapiens    P02750
• Low-density lipoprotein receptor-related protein 2 / Homo sapiens    P98164
• Lumican / Homo sapiens    P51884
• Lymphatic vessel endothelial hyaluronic acid receptor 1 / Homo sapiens    Q9Y5Y7
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Maltase-glucoamylase, intestinal / Homo sapiens    O43451
• Microfibril-associated glycoprotein 4 / Homo sapiens    P55083
• Mimecan / Homo sapiens    P20774
• Multimerin-1 / Homo sapiens    Q13201
• Myeloperoxidase / Homo sapiens    P05164
• Neogenin / Homo sapiens    Q92859
• Neuron navigator 2 / Homo sapiens    Q8IVL1
• Neuronal cell adhesion molecule / Homo sapiens    Q92823
• Plasma serine protease inhibitor / Homo sapiens    P05154
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Prolactin-inducible protein / Homo sapiens    P12273
• Prolargin / Homo sapiens    P51888
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens    Q07954
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Protein AMBP / Homo sapiens    P02760
• Ras-specific guanine nucleotide-releasing factor 1 / Homo sapiens    Q13972
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens    P08575
• Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens    Q15262
• Receptor-type tyrosine-protein phosphatase mu / Homo sapiens    P28827
• RNA-binding protein 44 / Homo sapiens    Q6ZP01
• Scavenger receptor cysteine-rich type 1 protein M130 / Homo sapiens    Q86VB7
• Secretogranin-3 / Homo sapiens    Q8WXD2
• Semaphorin-3F / Homo sapiens    Q13275
• Semaphorin-4D / Homo sapiens    Q92854
• Serotransferrin / Homo sapiens    P02787
• Sparc / Homo sapiens    P09486
• Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 / Homo sapiens    Q4LDE5
• Target of Nesh-SH3 / Homo sapiens    Q7Z7G0
• Thrombospondin-1 / Homo sapiens    P07996
• Transmembrane glycoprotein NMB / Homo sapiens    Q14956
• Transmembrane protein 87A / Homo sapiens    Q8NBN3
• Trem-like transcript 2 protein / Homo sapiens    Q5T2D2
• Uromodulin / Homo sapiens    P07911
• Vitronectin / Homo sapiens    P04004
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• Alpha-1-acid glycoprotein / Bos taurus    Q3SZR3
• Alpha-2-hs-glycoprotein / Bos taurus    P12763
• Alpha-1-acid glycoprotein / Canis lupus familiaris    F6Y713
• Zona pellucida sperm-binding protein matrix / Mus musculus    P20239    Q62005    P10761
• Alpha-1-acid glycoprotein / Ovis aries    W5P7S6
• Acetylcholine receptor protein / Torpedo californica    P02714    P02718    P02712    P02710
• Envelope glycoprotein / Friend murine leukemia virus    P03395
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Ascitic fluid (UBERON_0007795)  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)   Mature NK T cell (CL_0000814)  
• Blood Serum (UBERON_0001977)  
• Bone Marrow (UBERON_0002371)  
• Colon (UBERON_0001155)  
• Electric Organ (UBERON_0006869)  
• Liver (UBERON_0002107)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Urine (UBERON_0001088)  
• Zona Pellucida (UBERON_0000086)  
• Eveline (CVCL_A1LI)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• Jurkat (CVCL_0065)  
• LS174T (CVCL_1384)  
• Adipocytes (CL_0000136)  
• Adipose-derived stem cells (ADSCs) (CL_0000136)  
• Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)  

Reported structure

• N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Man(a1-?)[Gal(?1-?)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ NeuAc(a2-6)"
• N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-3)[NeuAc(a2-6)]GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ NeuAc(a2-?)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(?1-?)Man(a1-3)[Gal(b1-4)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)GlcNAc(?1-?) + NeuAc(a2-?)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ NeuAc"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ NeuAc"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ NeuAc(a2-3)"
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Structure 2772
• N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Structure 9470
• N-Linked / Complex / Structure 9546
• N-Linked / Complex / Structure 9565
• N-Linked / Complex / Structure 9636
• N-Linked / Complex / Structure 10039
• N-Linked / Complex / Structure 10436
• N-Linked / Complex / Structure 10655
• N-Linked / Complex / Structure 10700
• N-Linked / Complex / Structure 10929
• N-Linked / Complex / Structure 11250

Composition

• Hex:6 HexNAc:5 NeuAc:1 (avg mass : 2298.1026 )

Disease

• Cancer, breast (DOID:1612)
• Colon adenocarcinoma (DOID:234)
• Control/Healthy
• COVID-19 (DOID:0080600)
• Familial hepatic adenoma (DOID:111366)
• Mixed phenotype acute leukemia (DOID:9953)
• Multiple myeloma (DOID:9538)
• Prostate cancer (DOID:10283)
• T-cell childhood acute lymphocytic leukemia (DOID:0080145)

Reference

• Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
• Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
• Aberrant sialylation in a patient with a HNF1α variant and liver adenomatosis (2021 - Luisa Sturiale, Marie-Cécile Nassogne, Angelo Palmigiano, Angela Messina, Immacolata Speciale, Rosangela Artuso, Gaetano Bertino, Nicole Revencu, Xavier Stephénne, Cristina De Castro, Gert Matthijs, Rita Barone, Jaak Jaeken, Domenico Garozzo) / Status : Reviewed
• Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
• Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
• Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Glycoproteomic Analysis of MGL-Binding Proteins on Acute T-Cell Leukemia Cells. (2019 - Martina Pirro, Esmee Schoof, Sandra J. van Vliet, Yoann Rombouts, Alexandre Stella, Arnoud de Ru, Yassene Mohammed, Manfred Wuhrer, Peter A. van Veelen, Paul J. Hensbergen) / Status : Reviewed
• A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
• Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• In-depth analysis of site-specific N-glycosylation in vitronectin from human plasma by tandem mass spectrometry with immunoprecipitation (2014 - Hwang H, Lee JY, Lee HK, Park GW, Jeong HK, Moon MH, Kim JY, Yoo JS.) / Status : Reviewed
• Comparison of sialylated N-glycopeptide levels in serum of pancreatic cancer patients, acute pancreatitis patients, and healthy controls (2014 - Kontro H, Joenväärä S, Haglund C, Renkonen R) / Status : Reviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
• Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
• Site-specific glycoprofiling of N-linked glycopeptides using MALDI-TOF MS: strong correlation between signal strength and glycoform quantities. (2009 - Thaysen-Andersen M, Mysling S, Højrup P) / Status : Reviewed
• Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
• Structural analysis of murine zona pellucida glycans. Evidence for the expression of core 2-type O-glycans and the Sd(a) antigen. (2000 - Easton RL, Patankar MS, Lattanzio FA, Leaven TH, Morris HR, Clark GF, Dell A) / Status : Reviewed
• Structural determination of N-linked carbohydrates by matrix-assisted laser desorption/ionization-mass spectrometry following enzymatic release within sodium dodecyl sulfate-polyacrylamide electrophoresis gels: application to species-specific glycosylation of alpha1-acid glycoprotein. (1998 - Kuster B, Hunter A, Wheeler S, Dwek R, Harvey D) / Status : Reviewed
• Two-dimensional chromatography in the analysis of complex glycans from transferrin. (1998 - Charlwood J, Birrell H, Tolson D, Camilleri P) / Status : Reviewed
• Identification of the oligosaccharide structures of human coagulation factor X activation peptide at each glycosylation site. (1995 - Nakagawa H, Takahashi N, Fujikawa K, Kawamura Y, Iino M, Takeya H, Ogawa H, Suzuki K) / Status : Reviewed
• Reducing-end modification of N-linked oligosaccharides with tyrosine. (1994 - Tamura T, Wadhwa M, Rice K) / Status : Reviewed
• Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
• Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed
• The asparagine-linked oligosaccharides on bovine fetuin. Structural analysis of N-glycanase-released oligosaccharides by 500-megahertz 1H NMR spectroscopy. (1988 - Green E, Adelt G, Baenziger J, Wilson S, Van Halbeek H) / Status : Reviewed

Reported glycosite

• 4F2 cell-surface antigen heavy chain / Homo sapiens
  •        Asn-365
• ADAM DEC1 / Homo sapiens
  •        Asn-184
• Adenosine deaminase 2 / Homo sapiens
  •        Asn-378
• Adhesion G protein-coupled receptor F5 / Homo sapiens
  •        Asn-301
• Alpha-1-acid glycoprotein 1 / Homo sapiens
  •        Undefined site
  •        Asn-33
  •        Asn-72
  •        Asn-93
• Alpha-1-acid glycoprotein 2 / Homo sapiens
  •        Undefined site
  •        Asn-33
  •        Asn-72
  •        Asn-93
• Alpha-1-antichymotrypsin / Homo sapiens
  •        Asn-127
  •        Asn-271
• Alpha-1-antitrypsin / Homo sapiens
  •        Asn-107
  •        Asn-271
  •        Asn-414
• Alpha-2-HS-glycoprotein / Homo sapiens
  •        Asn-156
• Aminopeptidase n / Homo sapiens
  •        Asn-234
  •        Asn-735
• Angiotensin-converting enzyme / Homo sapiens
  •        Asn-509
• Angiotensin-converting enzyme 2 / Homo sapiens
  •        Undefined site
• Angiotensinogen / Homo sapiens
  •        Asn-47
• Apolipoprotein (a) / Homo sapiens
  •        Asn-3521
• Apolipoprotein B-100 / Homo sapiens
  •        Asn-185
  •        Asn-3411
• Apolipoprotein D / Homo sapiens
  •        Asn-65
  •        Asn-98
• Attractin / Homo sapiens
  •        Asn-1043
• Beta-2-glycoprotein 1 / Homo sapiens
  •        Asn-162
  •        Asn-253
• Biglycan / Homo sapiens
  •        Asn-270
  •        Asn-311
• Butyrophilin subfamily 1 member A1 / Homo sapiens
  •        Asn-215
• Carboxypeptidase N subunit 2 / Homo sapiens
  •        Asn-348
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
  •        Undefined site
• Catalase / Homo sapiens
  •        Asn-481
• CD109 antigen / Homo sapiens
  •        Asn-118
• CD16A-NK08-V/F genotype / Homo sapiens
  •        Asn-63
• CD16A-NK09-V/F genotype / Homo sapiens
  •        Asn-63
• CD16A-NK11-F/F genotype / Homo sapiens
  •        Asn-63
• CD16A-NK12-V/F genotype / Homo sapiens
  •        Asn-63
• CD16A-NK13-V/F genotype / Homo sapiens
  •        Asn-63
• CD276 antigen / Homo sapiens
  •        Asn-104
• CD44 antigen / Homo sapiens
  •        Asn-57
• CD59 glycoprotein / Homo sapiens
  •        Asn-43
• Ceruloplasmin / Homo sapiens
  •        Asn-138
  •        Asn-397
  •        Asn-762
• Cholesteryl ester transfer protein / Homo sapiens
  •        Asn-105
• Clusterin / Homo sapiens
  •        Asn-86
  •        Asn-103
  •        Asn-145
  •        Asn-291
  •        Asn-374
• Coagulation factor VIII / Homo sapiens
  •        Asn-1274
  •        Asn-1461
• Coagulation factor x / Homo sapiens
  •        Asn-221
  •        Asn-231
• Collagen alpha-2(VI) chain / Homo sapiens
  •        Asn-140
• Collagen alpha-3(VI) chain / Homo sapiens
  •        Asn-3037
• Complement c1r subcomponent / Homo sapiens
  •        Asn-125
• Complement factor h / Homo sapiens
  •        Asn-882
  •        Asn-911
• Contactin-4 / Homo sapiens
  •        Asn-764
• Corticosteroid-binding globulin / Homo sapiens
  •        Asn-96
• Decorin / Homo sapiens
  •        Asn-211
• Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens
  •        Asn-539
• Ecto-ADP-ribosyltransferase 4 / Homo sapiens
  •        Asn-257
• Endoplasmic reticulum aminopeptidase 2 / Homo sapiens
  •        Asn-714
• Endothelial cell-selective adhesion molecule / Homo sapiens
  •        Asn-213
• Ephrin-B2 / Homo sapiens
  •        Asn-36
• Epidermal growth factor receptor / Homo sapiens
  •        Asn-271
• Epithelial cell adhesion molecule / Homo sapiens
  •        Asn-74
• Fibrillin-1 / Homo sapiens
  •        Asn-1581
  •        Asn-2767
• Fibroblast growth factor receptor 1 / Homo sapiens
  •        Asn-317
• Fibroleukin / Homo sapiens
  •        Asn-336
• Fibromodulin / Homo sapiens
  •        Asn-166
• Fibronectin / Homo sapiens
  •        Asn-528
• Filamin-B / Homo sapiens
  •        Asn-2570
• Folate receptor alpha / Homo sapiens
  •        Asn-161
• Galectin-3-binding protein / Homo sapiens
  •        Asn-69
  •        Asn-551
• Gamma-glutamyltransferase light chain 1 / Homo sapiens
  •        Asn-167
• Gamma-glutamyltransferase light chain 2 / Homo sapiens
  •        Asn-160
• Gamma-glutamyltranspeptidase 1 / Homo sapiens
  •        Asn-511
• Haptoglobin / Homo sapiens
  •        Asn-184
  •        Asn-207
  •        Asn-211
  •        Asn-241
• Hemopexin / Homo sapiens
  •        Asn-64
  •        Asn-187
  •        Asn-453
• Hepatocyte growth factor receptor / Homo sapiens
  •        Asn-785
  •        Asn-1171
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Asn-144
  •        Asn-340
• Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •        Asn-205
• Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 4 / Homo sapiens
  •        Asn-177
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Asn-209
• Integrin alpha-2 / Homo sapiens
  •        Asn-343
• Integrin alpha-X / Homo sapiens
  •        Asn-899
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-517
• Interferon alpha/beta receptor 2 / Homo sapiens
  •        Asn-188
• Interleukin-6 receptor subunit beta / Homo sapiens
  •        Asn-157
• Kinesin-1 heavy chain / Homo sapiens
  •        Asn-308
• Kininogen-1 / Homo sapiens
  •        Asn-205
  •        Asn-294
• Lactotransferrin / Homo sapiens
  •        Asn-156
  •        Asn-497
• Laminin subunit alpha-2 / Homo sapiens
  •        Asn-2558
• Laminin subunit alpha-4 / Homo sapiens
  •        Asn-810
• Laminin subunit gamma-1 / Homo sapiens
  •        Asn-1241
  •        Asn-1395
• Leucine-rich alpha-2-glycoprotein / Homo sapiens
  •        Asn-325
• Low-density lipoprotein receptor-related protein 2 / Homo sapiens
  •        Asn-3355
• Lumican / Homo sapiens
  •        Asn-127
  •        Asn-160
  •        Asn-252
• Lymphatic vessel endothelial hyaluronic acid receptor 1 / Homo sapiens
  •        Asn-53
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-84
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-49
  •        Asn-101
  •        Asn-275
  •        Asn-356
• Maltase-glucoamylase, intestinal / Homo sapiens
  •        Asn-912
• Microfibril-associated glycoprotein 4 / Homo sapiens
  •        Asn-137
• Mimecan / Homo sapiens
  •        Asn-214
• Multimerin-1 / Homo sapiens
  •        Asn-576
• Myeloperoxidase / Homo sapiens
  •        Asn-355
  •        Asn-483
• Neogenin / Homo sapiens
  •        Asn-470
• Neuron navigator 2 / Homo sapiens
  •        Asn-1784
• Neuronal cell adhesion molecule / Homo sapiens
  •        Asn-223
• Plasma serine protease inhibitor / Homo sapiens
  •        Asn-262
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-499
• Prolactin-inducible protein / Homo sapiens
  •        Asn-105
• Prolargin / Homo sapiens
  •        Asn-289
  •        Asn-327
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
  •        Asn-729
  •        Asn-1825
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-78
• Protein AMBP / Homo sapiens
  •        Asn-250
• Ras-specific guanine nucleotide-releasing factor 1 / Homo sapiens
  •        Asn-872
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens
  •        Asn-421
  •        Asn-470
• Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
  •        Asn-101
• Receptor-type tyrosine-protein phosphatase mu / Homo sapiens
  •        Asn-131
• RNA-binding protein 44 / Homo sapiens
  •        Asn-110
• Scavenger receptor cysteine-rich type 1 protein M130 / Homo sapiens
  •        Asn-1001
  •        Asn-1027
• Secretogranin-3 / Homo sapiens
  •        Asn-346
• Semaphorin-3F / Homo sapiens
  •        Asn-53
• Semaphorin-4D / Homo sapiens
  •        Asn-419
• Serotransferrin / Homo sapiens
  •        Undefined site
  •        Asn-432
  •        Asn-630
• Sparc / Homo sapiens
  •        Asn-116
• Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 / Homo sapiens
  •        Asn-2779
• Target of Nesh-SH3 / Homo sapiens
  •        Asn-690
• Thrombospondin-1 / Homo sapiens
  •        Asn-521
  •        Asn-1067
• Transmembrane glycoprotein NMB / Homo sapiens
  •        Asn-275
• Transmembrane protein 87A / Homo sapiens
  •        Asn-62
• Trem-like transcript 2 protein / Homo sapiens
  •        Asn-89
• Uromodulin / Homo sapiens
  •        Asn-232
  •        Asn-322
• Vitronectin / Homo sapiens
  •        Asn-86
  •        Asn-169
  •        Asn-242
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-109
• Alpha-1-acid glycoprotein / Bos taurus
  •        Undefined site
• Alpha-2-hs-glycoprotein / Bos taurus
  •        Undefined site
  •        Asn-99
  •        Asn-156
  •        Asn-176
• Alpha-1-acid glycoprotein / Canis lupus familiaris
  •        Undefined site
• Zona pellucida sperm-binding protein matrix / Mus musculus
  •        Undefined site
• Alpha-1-acid glycoprotein / Ovis aries
  •        Undefined site
• Acetylcholine receptor protein / Torpedo californica
  •        Undefined site
• Envelope glycoprotein / Friend murine leukemia virus
  •        Asn-334 and/or Asn-341
  •        Asn-341 and/or Asn-334
  •        Asn-266
  •        Asn-302
  •        Asn-374
  •        Asn-410
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-282
  •        Asn-1098
  •        Asn-1159
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-282
  •        Asn-1098

Mass spectrometry observed peptide

• LVPVPITNATLDR (13aa)
  •    P19652    Asn-33     Alpha-1-acid glycoprotein 2 / Homo sapiens
• LVPVPITNATLDQITGK (17aa)
  •    P02763    Asn-33     Alpha-1-acid glycoprotein 1 / Homo sapiens
• SIVLEPIYWNSSNSK (15aa)
  •    P52799    Asn-36     Ephrin-B2 / Homo sapiens
• TAVNCSSDFDACLITK (16aa)
  •    P13987    Asn-43     CD59 glycoprotein / Homo sapiens
• HLVIHNESTCEQLAK (15aa)
  •    P01019    Asn-47     Angiotensinogen / Homo sapiens
• WQMNFTVR (8aa)
  •    P13473    Asn-49     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• ANQQLNFTEAK (11aa)
  •    Q9Y5Y7    Asn-53     Lymphatic vessel endothelial hyaluronic acid receptor 1 / Homo sapiens
• KANQQINFTEAK (12aa)
  •    Q9Y5Y7    Asn-53     Lymphatic vessel endothelial hyaluronic acid receptor 1 / Homo sapiens
• ATGTAHFFNFLLNTTDYR (18aa)
  •    Q13275    Asn-53     Semaphorin-3F / Homo sapiens
• AFNSTLPTMAQMEK (14aa)
  •    P16070    Asn-57     CD44 antigen / Homo sapiens
• NTTIFLK (7aa)
  •    Q8NBN3    Asn-62     Transmembrane protein 87A / Homo sapiens
• FHNESLISSQASSY (14aa)
  •    P08637    Asn-63     CD16A-NK13-V/F genotype / Homo sapiens
  •    P08637    Asn-63     CD16A-NK12-V/F genotype / Homo sapiens
  •    P08637    Asn-63     CD16A-NK08-V/F genotype / Homo sapiens
  •    P08637    Asn-63     CD16A-NK09-V/F genotype / Homo sapiens
  •    P08637    Asn-63     CD16A-NK11-F/F genotype / Homo sapiens
• CSDGWSFDATTLDDNGTMLFFK (22aa)
  •    P02790    Asn-64     Hemopexin / Homo sapiens
• CIQANYSLMENGK (13aa)
  •    P05090    Asn-65     Apolipoprotein D / Homo sapiens
• CIQANYSIMENGK (13aa)
  •    P05090    Asn-65     Apolipoprotein D / Homo sapiens
• RALGFENATQALGRA (15aa)
  •    Q08380    Asn-69     Galectin-3-binding protein / Homo sapiens
• SVQEIQATFFYFTPNKTEDTIFLR (24aa)
  •    P02763    Asn-72     Alpha-1-acid glycoprotein 1 / Homo sapiens
  •    P19652    Asn-72     Alpha-1-acid glycoprotein 2 / Homo sapiens
• SVQEIQATFFYFTPNK (16aa)
  •    P02763    Asn-72     Alpha-1-acid glycoprotein 1 / Homo sapiens
  •    P19652    Asn-72     Alpha-1-acid glycoprotein 2 / Homo sapiens
• AEMNGSK (7aa)
  •    P16422    Asn-74     Epithelial cell adhesion molecule / Homo sapiens
• SVVAPATDGGLNLTSTFLRK (20aa)
  •    P41222    Asn-78     Prostaglandin-h2 d-isomerase / Homo sapiens
• SSCGKENTSDPSIVIAFGR (19aa)
  •    P11279    Asn-84     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• NNATVHEQVGGPSLTSDLQAQSK (23aa)
  •    P04004    Asn-86     Vitronectin / Homo sapiens
• KKKEDALNETRE (12aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• VVNITMVALK (10aa)
  •    Q5T2D2    Asn-89     Trem-like transcript 2 protein / Homo sapiens
• QNQCFYNSSYLNVQR (15aa)
  •    P19652    Asn-93     Alpha-1-acid glycoprotein 2 / Homo sapiens
• QDQCIYNTTYINVQR (15aa)
  •    P02763    Asn-93     Alpha-1-acid glycoprotein 1 / Homo sapiens
• QDQCIYNTTYLNVQR (15aa)
  •    P02763    Asn-93     Alpha-1-acid glycoprotein 1 / Homo sapiens
• AQLLQGLGFNLTER (14aa)
  •    P08185    Asn-96     Corticosteroid-binding globulin / Homo sapiens
• ADGTVNQIEGEATPVNLTEPAK (22aa)
  •    P05090    Asn-98     Apolipoprotein D / Homo sapiens
• RPTGEVYDIEIDTLETTCHVLDPTPLANCSVR (32aa)
  •    P12763    Asn-99     Alpha-2-hs-glycoprotein / Bos taurus
• ENDTHCIDFSYLLYSQK (17aa)
  •    Q15262    Asn-101     Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
• IAVQFGPGFSWIANFTK (17aa)
  •    P13473    Asn-101     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• ELPGVCNETMMALWEECKPCLK (22aa)
  •    P10909    Asn-103     Clusterin / Homo sapiens
• TAIFPDIIAQGNASIR (16aa)
  •    Q5ZPR3    Asn-104     CD276 antigen / Homo sapiens
• TFYWDFYTNR (10aa)
  •    P12273    Asn-105     Prolactin-inducible protein / Homo sapiens
• SIDVSIQNVSVVFK (14aa)
  •    P11597    Asn-105     Cholesteryl ester transfer protein / Homo sapiens
• ADTHDEIIEGINFNITEIPEAQIHEGFQEIIR (32aa)
  •    P01009    Asn-107     Alpha-1-antitrypsin / Homo sapiens
• DIVEYYNDSNGSHVLQGR (18aa)
  •    P25311    Asn-109     Zinc-alpha-2-glycoprotein / Homo sapiens
• MDLLEPFFSVSQDTNTESTQFQSSELEDSTDYAFLNK (37aa)
  •    Q6ZP01    Asn-110     RNA-binding protein 44 / Homo sapiens
• VCSNDNK (7aa)
  •    P09486    Asn-116     Sparc / Homo sapiens
• TQDEIIFSNSTR (12aa)
  •    Q6YHK3    Asn-118     CD109 antigen / Homo sapiens
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• MLLTFHTDFSNEENGTIMFYK (21aa)
  •    P00736    Asn-125     Complement c1r subcomponent / Homo sapiens
• KLHINHNNLTESVGPLPK (18aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• LHINHNNLTESVGPLPK (17aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• TLNQSSDELQLSMGNAMFVK (20aa)
  •    P01011    Asn-127     Alpha-1-antichymotrypsin / Homo sapiens
• TLNQSSDELQLSMGN (15aa)
  •    P01011    Asn-127     Alpha-1-antichymotrypsin / Homo sapiens
• TINQSSDEIQISMGNAMFVK (20aa)
  •    P01011    Asn-127     Alpha-1-antichymotrypsin / Homo sapiens
• RTLNQSSDELQLSMGNAMFVKE (22aa)
  •    P01011    Asn-127     Alpha-1-antichymotrypsin / Homo sapiens
• VNNGPLGNPIWNISGDPTR (19aa)
  •    P28827    Asn-131     Receptor-type tyrosine-protein phosphatase mu / Homo sapiens
• VDIEDFENNTAYAK (14aa)
  •    P55083    Asn-137     Microfibril-associated glycoprotein 4 / Homo sapiens
• EHEGAIYPDNTTDFQR (16aa)
  •    P00450    Asn-138     Ceruloplasmin / Homo sapiens
• GTFTDCALANMTEQIR (16aa)
  •    P12110    Asn-140     Collagen alpha-2(VI) chain / Homo sapiens
• QIEEFINQSSPFY (13aa)
  •    P10909    Asn-145     Clusterin / Homo sapiens
• QLEEFLNQSSPF (12aa)
  •    P10909    Asn-145     Clusterin / Homo sapiens
• LCPDCPLLAPLNDSR (15aa)
  •    P12763    Asn-156     Alpha-2-hs-glycoprotein / Bos taurus
• RTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (32aa)
  •    P02788    Asn-156     Lactotransferrin / Homo sapiens
• VCQDCPLLAPLNDTR (15aa)
  •    P02765    Asn-156     Alpha-2-HS-glycoprotein / Homo sapiens
• ETHLETNFTLK (11aa)
  •    P40189    Asn-157     Interleukin-6 receptor subunit beta / Homo sapiens
• LGSFEGLVNLTFIHLQHNR (19aa)
  •    P51884    Asn-160     Lumican / Homo sapiens
• GWNWTSGFNK (10aa)
  •    P15328    Asn-161     Folate receptor alpha / Homo sapiens
• VYKPSAGNNSLYR (13aa)
  •    P02749    Asn-162     Beta-2-glycoprotein 1 / Homo sapiens
• IYIDHNNITR (10aa)
  •    Q06828    Asn-166     Fibromodulin / Homo sapiens
• NGSLFAFR (8aa)
  •    P04004    Asn-169     Vitronectin / Homo sapiens
• VVHAVEVALATFNAESNGSYLQLVEISR (28aa)
  •    P12763    Asn-176     Alpha-2-hs-glycoprotein / Bos taurus
• MVSHHNLTTGATLINEQWLLTTAK (24aa)
  •    P00738    Asn-184     Haptoglobin / Homo sapiens
• EHAVFTSNQEEQDPANHTCGVK (22aa)
  •    O15204    Asn-184     ADAM DEC1 / Homo sapiens
• QVLFLDTVYGNCSTHFTVK (19aa)
  •    P04114    Asn-185     Apolipoprotein B-100 / Homo sapiens
• SWPAVGNCSSALR (13aa)
  •    P02790    Asn-187     Hemopexin / Homo sapiens
• SWPAVGNCSSAIR (13aa)
  •    P02790    Asn-187     Hemopexin / Homo sapiens
• GNMSGNFTYIIDK (13aa)
  •    P48551    Asn-188     Interferon alpha/beta receptor 2 / Homo sapiens
• ITYSIVQTNCSK (12aa)
  •    P01042    Asn-205     Kininogen-1 / Homo sapiens
• TPLTANITK (9aa)
  •    P01877    Asn-205     Immunoglobulin heavy constant alpha 2 / Homo sapiens
• GLTFQQNASSMCGPDQDTAIR (21aa)
  •    P01871    Asn-209     Immunoglobulin heavy constant mu / Homo sapiens
  •    VAR_003904   215:V→G   dbSNP:rs12365
• GLTFQQNASSMCVPDQDTAIR (21aa)
  •    P01871    Asn-209     Immunoglobulin heavy constant mu / Homo sapiens
• GITFQQNASSMCVPDQDTAIR (21aa)
  •    P01871    Asn-209     Immunoglobulin heavy constant mu / Homo sapiens
• IADTNITSIPQGIPPSITEIHIDGNK (26aa)
  •    P07585    Asn-211     Decorin / Homo sapiens
• KNLFLNHSENATAKD (15aa)
  •    P00738    Asn-211     Haptoglobin / Homo sapiens
  •    P00738    Asn-207     Haptoglobin / Homo sapiens
• GSLSLTNLSSSMAGVYVCK (19aa)
  •    Q96AP7    Asn-213     Endothelial cell-selective adhesion molecule / Homo sapiens
• LNNLTFLYLDHNALESVPLNLPESLR (26aa)
  •    P20774    Asn-214     Mimecan / Homo sapiens
• KLNNLTFLYLDHNALESVPLNLPESLR (27aa)
  •    P20774    Asn-214     Mimecan / Homo sapiens
• KNVSCYIQNLLLGQEKK (17aa)
  •    Q13410    Asn-215     Butyrophilin subfamily 1 member A1 / Homo sapiens
• FNHTQTIQQK (10aa)
  •    Q92823    Asn-223     Neuronal cell adhesion molecule / Homo sapiens
• CNTAAPMWLNGTHPSSDEGIVSR (23aa)
  •    P07911    Asn-232     Uromodulin / Homo sapiens
• AEFNITIIHPK (11aa)
  •    P15144    Asn-234     Aminopeptidase n / Homo sapiens
• VVLHPNYSQVDIGLIK (16aa)
  •    P00738    Asn-241     Haptoglobin / Homo sapiens
• KVVLHPNYSQVDIGLIKL (18aa)
  •    P00738    Asn-241     Haptoglobin / Homo sapiens
• VVIHPNYSQVDIGIIK (16aa)
  •    P00738    Asn-241     Haptoglobin / Homo sapiens
• YFYNGTSMACETFQYGGCMGNGNNFVTEK (29aa)
  •    P02760    Asn-250     Protein AMBP / Homo sapiens
• ISHNEIADSGIPGNSFNVSSIVEIDISYNK (30aa)
  •    P51884    Asn-252     Lumican / Homo sapiens
• IGNWSAMPSCK (11aa)
  •    P02749    Asn-253     Beta-2-glycoprotein 1 / Homo sapiens
• LGNWSAMPSCK (11aa)
  •    P02749    Asn-253     Beta-2-glycoprotein 1 / Homo sapiens
• VINMSYHPR (9aa)
  •    Q93070    Asn-257     Ecto-ADP-ribosyltransferase 4 / Homo sapiens
• VVGVPYQGNATALFILPSEGK (21aa)
  •    P05154    Asn-262     Plasma serine protease inhibitor / Homo sapiens
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270     Biglycan / Homo sapiens
• YTGNASALFILPDQDK (16aa)
  •    P01011    Asn-271     Alpha-1-antichymotrypsin / Homo sapiens
• KYLGNATAIFFLPDEGKL (18aa)
  •    P01009    Asn-271     Alpha-1-antitrypsin / Homo sapiens
• DTCPPLMLYNPTTYQMDVNPEGK (23aa)
  •    P00533    Asn-271     Epidermal growth factor receptor / Homo sapiens
• LNSSTIK (7aa)
  •    P13473    Asn-275     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• DLPIMFDVLIHDPSHFLNYSTINYK (25aa)
  •    Q14956    Asn-275     Transmembrane glycoprotein NMB / Homo sapiens
• FLLKYNENGTIT (12aa)
  •    P0DTC2    Asn-282     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTITDAVDCALDPLSE (17aa)
  •    P0DTC2    Asn-282     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NSFNISNLLVLHLSHNR (17aa)
  •    P51888    Asn-289     Prolargin / Homo sapiens
• REIRHNSTGCLRM (13aa)
  •    P10909    Asn-291     Clusterin / Homo sapiens
• RHNSTGCLRM (10aa)
  •    P10909    Asn-291     Clusterin / Homo sapiens
• LNAENNATFYFK (12aa)
  •    P01042    Asn-294     Kininogen-1 / Homo sapiens
• EVLSSNVSWR (10aa)
  •    Q8IZF2    Asn-301     Adhesion G protein-coupled receptor F5 / Homo sapiens
• RTTIVICCSPSSYNESETKS (20aa)
  •    P33176    Asn-308     Kinesin-1 heavy chain / Homo sapiens
• IIQVVYIHSNNITK (14aa)
  •    P21810    Asn-311     Biglycan / Homo sapiens
• TAGVNTTDK (9aa)
  •    P11362    Asn-317     Fibroblast growth factor receptor 1 / Homo sapiens
• QDFNITDISLLEHR (14aa)
  •    P07911    Asn-322     Uromodulin / Homo sapiens
• MFSQNDTR (8aa)
  •    P02750    Asn-325     Leucine-rich alpha-2-glycoprotein / Homo sapiens
• INGTQICPN (9aa)
  •    P51888    Asn-327     Prolargin / Homo sapiens
• LHVGNYNGTAGDALR (15aa)
  •    Q14314    Asn-336     Fibroleukin / Homo sapiens
• LAGKPTHVNVSVVMAEVDGTC (21aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• YFFNVSDEAAIIEK (14aa)
  •    P17301    Asn-343     Integrin alpha-2 / Homo sapiens
• NATDNISK (8aa)
  •    Q8WXD2    Asn-346     Secretogranin-3 / Homo sapiens
• LYLGSNNLTALHPALFQNLSK (21aa)
  •    P22792    Asn-348     Carboxypeptidase N subunit 2 / Homo sapiens
• NMSNQLGLLAVNQR (14aa)
  •    P05164    Asn-355     Myeloperoxidase / Homo sapiens
• VQPFNVTQGK (10aa)
  •    P13473    Asn-356     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• DASSFIAEWQNITK (14aa)
  •    P08195    Asn-365     4F2 cell-surface antigen heavy chain / Homo sapiens
• LANLTQGEDQYYLR (14aa)
  •    P10909    Asn-374     Clusterin / Homo sapiens
• NILDALMLNTTR (12aa)
  •    Q9NZK5    Asn-378     Adenosine deaminase 2 / Homo sapiens
• ENLTAPGSDSAVFFEQGTTR (20aa)
  •    P00450    Asn-397     Ceruloplasmin / Homo sapiens
• VVNPTQK (7aa)
  •    P01009    Asn-414     Alpha-1-antitrypsin / Homo sapiens
• DVNYTQIVVDR (11aa)
  •    Q92854    Asn-419     Semaphorin-4D / Homo sapiens
• SFHNFTLCYIK (11aa)
  •    P08575    Asn-421     Receptor-type tyrosine-protein phosphatase C / Homo sapiens
• CGIVPVIAENYNK (13aa)
  •    P02787    Asn-432     Serotransferrin / Homo sapiens
• KCGLVPVLAENYNKS (15aa)
  •    P02787    Asn-432     Serotransferrin / Homo sapiens
• CGLVPVLAENYNK (13aa)
  •    P02787    Asn-432     Serotransferrin / Homo sapiens
• CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK (33aa)
  •    P02787    Asn-432     Serotransferrin / Homo sapiens
  •    VAR_058199   448:I→V   dbSNP:rs2692696
• CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa)
  •    P02787    Asn-432     Serotransferrin / Homo sapiens
  •    VAR_058199   448:I→V   dbSNP:rs2692696
• ALPQPQNVTSLLGCTH (16aa)
  •    P02790    Asn-453     Hemopexin / Homo sapiens
• AIPQPQNVTSIIGCTH (16aa)
  •    P02790    Asn-453     Hemopexin / Homo sapiens
• NGSAAMCHFTTK (12aa)
  •    P08575    Asn-470     Receptor-type tyrosine-protein phosphatase C / Homo sapiens
• TPASDPHGDNLTYSVFYTK (19aa)
  •    Q92859    Asn-470     Neogenin / Homo sapiens
• NFTEVHPDYGSHIQALLDK (19aa)
  •    P04040    Asn-481     Catalase / Homo sapiens
• SYNDSVDPR (9aa)
  •    P05164    Asn-483     Myeloperoxidase / Homo sapiens
• RTAGWNIPMGLLFNQTGSCKF (21aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• KWNNTGCQALPSQDEGPSKA (20aa)
  •    P01833    Asn-499     Polymeric immunoglobulin receptor / Homo sapiens
• NETHFDAGAK (10aa)
  •    P12821    Asn-509     Angiotensin-converting enzyme / Homo sapiens
• IHNQIIPNVTTVER (14aa)
  •    Q14390    Asn-160     Gamma-glutamyltransferase light chain 2 / Homo sapiens
  •    P19440    Asn-511     Gamma-glutamyltranspeptidase 1 / Homo sapiens
  •    Q9BX51    Asn-167     Gamma-glutamyltransferase light chain 1 / Homo sapiens
• LCNNPTPQFGGK (12aa)
  •    P07996    Asn-521     Thrombospondin-1 / Homo sapiens
• DQCIVDDITYNVNDTFHK (18aa)
  •    P02751    Asn-528     Fibronectin / Homo sapiens
• CQEAINATCK (10aa)
  •    P78536    Asn-539     Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens
• KCQEAINATCK (11aa)
  •    P78536    Asn-539     Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens
• AAIPSALDTNSSK (13aa)
  •    Q08380    Asn-551     Galectin-3-binding protein / Homo sapiens
• KAAIPSALDTNSSKS (15aa)
  •    Q08380    Asn-551     Galectin-3-binding protein / Homo sapiens
• INNLTVSLEMEK (12aa)
  •    Q13201    Asn-576     Multimerin-1 / Homo sapiens
• QQQHIFGSNVTDCSGNFCIFR (21aa)
  •    P02787    Asn-630     Serotransferrin / Homo sapiens
• NVSVDSTHPTK (11aa)
  •    Q7Z7G0    Asn-690     Target of Nesh-SH3 / Homo sapiens
• NISDISENLK (10aa)
  •    Q6P179    Asn-714     Endoplasmic reticulum aminopeptidase 2 / Homo sapiens
• IETILLNGTDR (11aa)
  •    Q07954    Asn-729     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
• NNTNNWR (7aa)
  •    P15144    Asn-735     Aminopeptidase n / Homo sapiens
• ELHHLQEQNVSNAFLDK (17aa)
  •    P00450    Asn-762     Ceruloplasmin / Homo sapiens
• KELHHLQEQNVSNAFLDKG (19aa)
  •    P00450    Asn-762     Ceruloplasmin / Homo sapiens
• NESVHPFSPFEVK (13aa)
  •    Q8IWV2    Asn-764     Contactin-4 / Homo sapiens
• NFTVACQHR (9aa)
  •    P08581    Asn-785     Hepatocyte growth factor receptor / Homo sapiens
• RPASNVSASIQR (12aa)
  •    Q16363    Asn-810     Laminin subunit alpha-4 / Homo sapiens
• NSSEFPLFSYNNGVVMTSCR (20aa)
  •    Q13972    Asn-872     Ras-specific guanine nucleotide-releasing factor 1 / Homo sapiens
• IPCSQPPQIEHGTINSSR (18aa)
  •    P08603    Asn-882     Complement factor h / Homo sapiens
• IIITANVSSENNTPR (15aa)
  •    P20702    Asn-899     Integrin alpha-X / Homo sapiens
• ISEENETTCYMGK (13aa)
  •    P08603    Asn-911     Complement factor h / Homo sapiens
• ILGTEEPSNVTVK (13aa)
  •    O43451    Asn-912     Maltase-glucoamylase, intestinal / Homo sapiens
• GNESSLWDCPAR (12aa)
  •    Q86VB7    Asn-1001     Scavenger receptor cysteine-rich type 1 protein M130 / Homo sapiens
• EDAAVNCTDISVQK (14aa)
  •    Q86VB7    Asn-1027     Scavenger receptor cysteine-rich type 1 protein M130 / Homo sapiens
• WGHSECGHKEDAAVNCTDISVQK (23aa)
  •    Q86VB7    Asn-1027     Scavenger receptor cysteine-rich type 1 protein M130 / Homo sapiens
• CIEGSYKGPVKMPSQAPTGNFYPQPLLNSSMCLEDSR (37aa)
  •    O75882    Asn-1043     Attractin / Homo sapiens
• VVNSTTGPGEHIR (13aa)
  •    P07996    Asn-1067     Thrombospondin-1 / Homo sapiens
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EGVFVSNGTHWFVTQR (16aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• KNH (3aa)
  •    P0DTC2    Asn-1159     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• KYFKNHTS (8aa)
  •    P0DTC2    Asn-1159     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NETHNPTVK (9aa)
  •    P08581    Asn-1171     Hepatocyte growth factor receptor / Homo sapiens
• NISQDLEK (8aa)
  •    P11047    Asn-1241     Laminin subunit gamma-1 / Homo sapiens
• SLNDSTNR (8aa)
  •    P00451    Asn-1274     Coagulation factor VIII / Homo sapiens
• IPAINQTITEANEK (14aa)
  •    P11047    Asn-1395     Laminin subunit gamma-1 / Homo sapiens
• NNLSLAILTLEMTGDQR (17aa)
  •    P00451    Asn-1461     Coagulation factor VIII / Homo sapiens
• AWGTPCEMCPAVNTSEYK (18aa)
  •    P35555    Asn-1581     Fibrillin-1 / Homo sapiens
• GNGTAQSADLR (11aa)
  •    Q8IVL1    Asn-1784     Neuron navigator 2 / Homo sapiens
• NSTTLVMHMK (10aa)
  •    Q07954    Asn-1825     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
• NESGIILLGSGGTPAPPR (18aa)
  •    P24043    Asn-2558     Laminin subunit alpha-2 / Homo sapiens
• HVGNQQYNVTYVVKER (16aa)
  •    O75369    Asn-2570     Filamin-B / Homo sapiens
• TAIFAFNISHVSNK (14aa)
  •    P35555    Asn-2767     Fibrillin-1 / Homo sapiens
• KPNPVMNGSIK (11aa)
  •    Q4LDE5    Asn-2779     Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 / Homo sapiens
• QNLTVTDR (8aa)
  •    P12111    Asn-3037     Collagen alpha-3(VI) chain / Homo sapiens
• VGMDGTNK (8aa)
  •    P98164    Asn-3355     Low-density lipoprotein receptor-related protein 2 / Homo sapiens
• VEGSHNSTVSLTTK (14aa)
  •    P04114    Asn-3411     Apolipoprotein B-100 / Homo sapiens
• WEYCNLTR (8aa)
  •    P08519    Asn-3521     Apolipoprotein (a) / Homo sapiens