Hex:7 HexNAc:6

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Canis familiaris (Dog)
• Mesocricetus auratus (Golden hamster)
• Mus musculus (House mouse)
• Ovis aries (Sheep)
• Rattus norvegicus (Norway rat)
• Columba livia (Domestic pigeon)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• 5'-AMP-activated protein kinase catalytic subunit alpha-2 / Homo sapiens    P54646
• Alkaline phosphatase, intestinal / Homo sapiens    P09923
• Alpha-1-acid glycoprotein 1 / Homo sapiens    P02763
• Alpha-1-acid glycoprotein 2 / Homo sapiens    P19652
• Alpha-galactosidase A / Homo sapiens    P06280
• Alpha-n-acetylglucosaminidase / Homo sapiens    P54802
• Aminopeptidase n / Homo sapiens    P15144
• Apolipoprotein d / Homo sapiens    P05090
• Beta-1,4-galactosyltransferase 3 / Homo sapiens    O60512
• Biglycan / Homo sapiens    P21810
• Calcium-activated chloride channel regulator 2 / Homo sapiens    Q9UQC9
• Calponin-3 / Homo sapiens    Q15417
• Carboxypeptidase D / Homo sapiens    O75976
• Cathepsin D / Homo sapiens    P07339
• Cation-independent mannose-6-phosphate receptor / Homo sapiens    P11717
• CD166 antigen / Homo sapiens    Q13740
• CD276 antigen / Homo sapiens    Q5ZPR3
• CD44 antigen / Homo sapiens    P16070
• CD59 glycoprotein / Homo sapiens    P13987
• Choline transporter-like protein 2 / Homo sapiens    Q8IWA5
• Clusterin / Homo sapiens    P10909
• CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 / Homo sapiens    Q11201
• Coagulation factor x / Homo sapiens    P00742
• Collagen alpha-1(VI) chain / Homo sapiens    P12109
• CTP synthase 1 / Homo sapiens    P17812
• Desmoglein-2 / Homo sapiens    Q14126
• Dipeptidyl peptidase 1 / Homo sapiens    P53634
• Disintegrin and metalloproteinase domain-containing protein 15 / Homo sapiens    Q13444
• Ecto-adp-ribosyltransferase 3 / Homo sapiens    Q13508
• Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens    Q9Y5L3
• Epithelial cell adhesion molecule / Homo sapiens    P16422
• Equilibrative nucleoside transporter 1 / Homo sapiens    Q99808
• Erythropoietin / Homo sapiens    P01588
• Erythropoietin - bi / Homo sapiens    P01588
• Erythropoietin - tetra / Homo sapiens    P01588
• Fibromodulin / Homo sapiens    Q06828
• Fibronectin / Homo sapiens    P02751
• Folate receptor alpha / Homo sapiens    P15328
• Gamma-glutamyltranspeptidase 1 / Homo sapiens    P19440
• Golgi apparatus protein 1 / Homo sapiens    Q92896
• Haptoglobin / Homo sapiens    P00738
• Hemopexin / Homo sapiens    P02790
• Inactive tyrosine-protein kinase 7 / Homo sapiens    Q13308
• Inositol monophosphatase 3 / Homo sapiens    Q9NX62
• Integrin alpha-6 / Homo sapiens    P23229
• Integrin alpha-L / Homo sapiens    P20701
• Integrin beta-1 / Homo sapiens    P05556
• Intercellular adhesion molecule-3 (CD50) / Homo sapiens    P32942
• Interferon gamma / Homo sapiens    P01579
• Keratin, type i cytoskeletal 18 / Homo sapiens    P05783
• Kininogen-1 / Homo sapiens    P01042
• Laminin subunit alpha-5 / Homo sapiens    O15230
• Laminin subunit gamma-1 / Homo sapiens    P11047
• Latent transforming growth factor beta binding protein 1 / Homo sapiens    Q14766
• Leucyl-cystinyl aminopeptidase / Homo sapiens    Q9UIQ6
• Low-density lipoprotein receptor / Homo sapiens    P01130
• Lysosomal acid phosphatase / Homo sapiens    P11117
• Lysosome membrane protein 2 / Homo sapiens    Q14108
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Myelin protein P0 / Homo sapiens    P25189
• Nectin-1 / Homo sapiens    Q15223
• Neuroendocrine convertase 2 / Homo sapiens    P16519
• Osteopetrosis-associated transmembrane protein 1 / Homo sapiens    Q86WC4
• Plasma alpha-L-fucosidase / Homo sapiens    Q9BTY2
• Podocalyxin / Homo sapiens    O00592
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Prolactin-inducible protein / Homo sapiens    P12273
• Prolargin / Homo sapiens    P51888
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens    Q07954
• Prorenin / Homo sapiens    P00797
• Prosaposin / Homo sapiens    P07602
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Protein CASC4 / Homo sapiens    Q6P4E1
• Protein GPR107 / Homo sapiens    Q5VW38
• Protein tweety homolog 3 / Homo sapiens    Q9C0H2
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens    P08575
• Recombinant mature angiotensin-converting enzyme 2 - DRAFT DATA / Homo sapiens    Q9BYF1
• Recombinant plasminogen - [r580s] / Homo sapiens    P00750
• Sortilin / Homo sapiens    Q99523
• Sparc / Homo sapiens    P09486
• Tenascin / Homo sapiens    P24821
• Thrombospondin-1 / Homo sapiens    P07996
• Thrombospondin-3 / Homo sapiens    P49746
• Transferrin receptor protein 1 / Homo sapiens    P02786
• Transmembrane 9 superfamily member 3 / Homo sapiens    Q9HD45
• Transmembrane glycoprotein NMB / Homo sapiens    Q14956
• UDP-glucose:glycoprotein glucosyltransferase 2 / Homo sapiens    Q9NYU1
• Uncharacterized protein from Fluid / Homo sapiens
• Uromodulin / Homo sapiens    P07911
• Von willebrand factor / Homo sapiens    P04275
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• Alpha-1-acid glycoprotein / Bos taurus    Q3SZR3
• Platelet glycoprotein IV / Bos taurus    P26201
• Alpha-1-acid glycoprotein / Canis familiaris    F6Y713
• Lysosome-associated membrane glycoprotein 1 / Mus musculus    P11438
• Major urinary protein / Mus musculus
• Neuronal cell adhesion molecule / Mus musculus    Q810U4
• Serotransferrin / Mus musculus    Q921I1
• Sodium/potassium-transporting ATPase subunit beta-3 / Mus musculus    P97370
• Alpha-1-acid glycoprotein / Ovis aries    W5P7S6
• Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus    P08289
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
• Ovalbumin (hi) / Columba livia
• Ovalbumin (lo) / Columba livia
• Ovomucoid / Columba livia
• Ovotransferrin / Columba livia    R7VTP9
• Recombinant Spike glycoprotein (FreeStyle 293-F) - DRAFT DATA / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) - DRAFT DATA / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Amnion (UBERON_0000305)   FL (CVCL_1905)  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Brain (UBERON_0000955)  
• Kidney (UBERON_0002113)   BHK-21 (CVCL_1914)  
• Kidney (UBERON_0002113)   BHK-21 (CVCL_1914)   Plasma Membrane (GO_0005886)  
• Kidney (UBERON_0002113)   BHK21/13/Py6 (CVCL_LM74)   Plasma Membrane (GO_0005886)  
• Liver (UBERON_0002107)   AH130 (CVCL_4367)  
• Liver (UBERON_0002107)  
• Mammary Gland (UBERON_0001911)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)   CHO B8-300 (CVCL_VU03)  
• Ovary (UBERON_0000992)   IM4/IV (CVCL_VT64)  
• Ovary (UBERON_0000992)   IM4/V/IV (CVCL_VT67)  
• Pleura (UBERON_0000977)   K-562 (CVCL_0004)  
• Urine (UBERON_0001088)  
• 3Y1-B clone 1 (CVCL_4563)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• Egg Cell   Egg White  
• Leukocyte (CL_0000738)  
• T-Lymphocyte (CL_0000084)  
• Cerebrospinal Fluid Secretion (GO_0033326)  

Reported structure

• N-Linked / Complex / Structure 720
• N-Linked / Complex / Gal(a1-4)Gal(b1-4)GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[Gal(a1-4)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-3)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(?1-?)[Gal(b1-4)GlcNAc(?1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)GlcNAc(?1-?)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-3)GlcNAc(b1-3)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"Gal(b1-4)GlcNAc(b1-3)"
• N-Linked / Complex / Gal(b1-?)GlcNAc(?1-?)[Gal(b1-?)GlcNAc(?1-?)]Man(a1-?)[Gal(b1-?)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-?)GlcNAc(?1-?)"

Composition

• Hex:7 HexNAc:6 (avg mass : 2372.1821 )

Disease

• Anemia, Aplastic (DOID:12449)
• Cancer, breast (DOID:1612)
• Carcinoma (DOID:305)
• Carcinoma, Hepatocellular (DOID:684)
• COVID-19 (DOID:0080600)
• Gangliosidosis GM1 (DOID:3322)
• Leukemia, Myloid, Chronic (DOID:8552)
• Prostate cancer (DOID:10283)

Reference

• Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Unreviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
• Site-specific analysis of the SARS-CoV-2 glycan shield (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Unreviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Protein and Site Specificity of Fucosylation in Liver-Secreted Glycoproteins (2014 - Pompach P, Ashline DJ, Brnakova Z, Benicky J, Sanda M, Goldman R.) / Status : Reviewed
• Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD (2012 - Halim A, Nilsson J, Rüetschi U, Hesse C, Larson G) / Status : Reviewed
• Enrichment of glycopeptides for glycan structure and attachment site identification (2009 - Nilsson J, Rüetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G.) / Status : Reviewed
• Structural study of N-linked oligosaccharides of human intercellular adhesion molecule-3 (CD50). (2001 - Funatsu O, Sato T, Kotovuori P, Gahmberg CG, Ikekita M, Furukawa K) / Status : Reviewed
• N-glycan structures from the major glycoproteins of pigeon egg white: predominance of terminal Gal alpha(1)Gal. (2001 - Takahashi N, Khoo K, Suzuki N, Johnson J, Lee Y) / Status : Reviewed
• Remodeling of sugar chain structures of human interferon-gamma. (2000 - Fukuta K, Abe R, Yokomatsu T, Kono N, Asanagi M, Omae F, Minowa M, Takeuchi M, Makino T) / Status : Reviewed
• Glycosylated major urinary protein of the house mouse: characterization of its N-linked oligosaccharides. (2000 - Mechref Y, Zidek L, Ma W, Novotny M) / Status : Reviewed
• Structural analysis of trisialylated biantennary glycans isolated from mouse serum transferrin. Characterization of the sequence Neu5Gc(alpha 2-3)Gal(beta 1-3)[Neu5Gc(alpha 2-6)]GlcNAc(beta 1-2)Man. (2000 - Coddeville B, Regoeczi E, Strecker G, Plancke Y, Spik G) / Status : Reviewed
• Structural determination of N-linked carbohydrates by matrix-assisted laser desorption/ionization-mass spectrometry following enzymatic release within sodium dodecyl sulfate-polyacrylamide electrophoresis gels: application to species-specific glycosylation of alpha1-acid glycoprotein. (1998 - Kuster B, Hunter A, Wheeler S, Dwek R, Harvey D) / Status : Reviewed
• Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
• Biological and physicochemical characterization of recombinant human erythropoietins fractionated by Mono Q column chromatography and their modification with sialyltransferase. (1996 - Morimoto K, Tsuda E, Said A, Uchida E, Hatakeyama S, Ueda M, Hayakawa T) / Status : Reviewed
• Identification of the oligosaccharide structures of human coagulation factor X activation peptide at each glycosylation site. (1995 - Nakagawa H, Takahashi N, Fujikawa K, Kawamura Y, Iino M, Takeya H, Ogawa H, Suzuki K) / Status : Reviewed
• Structural study of the sugar chains of human leukocyte common antigen CD45. (1993 - Sato T, Furukawa K, Autero M, Gahmberg C, Kobata A) / Status : Reviewed
• Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993 - Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A) / Status : Reviewed
• Characterization of the oligosaccharide structures on recombinant human prorenin expressed in Chinese hamster ovary cells. (1992 - Aeed P, Guido D, Mathews W, Elhammer A) / Status : Reviewed
• Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
• Oligosaccharide structures present on asparagine-289 of recombinant human plasminogen expressed in a Chinese hamster ovary cell line. (1991 - Davidson D, Castellino F) / Status : Reviewed
• Structures of the asparagine-linked oligosaccharides of an alkaline phosphatase, kasahara isozyme, purified from FL amnion cells. (1990 - Endo T, Higashino K, Hada T, Imanishi H, Muratani K, Kochibe N, Kobata A) / Status : Reviewed
• Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
• Transfection with fragments of the adenovirus 12 gene induces tumorigenicity-associated alteration of N-linked sugar chains in rat cells. (1990 - Hiraizumi S, Takasaki S, Shiroki K, Kochibe N, Kobata A) / Status : Reviewed
• Relationship between sugar chain structure and biological activity of recombinant human erythropoietin produced in Chinese hamster ovary cells. (1989 - Takeuchi M, Inoue N, Strickland T, Kubota M, Wada M, Shimizu R, Hoshi S, Kozutsumi H, Takasaki S, Kobata A) / Status : Reviewed
• Comparative study of the asparagine-linked sugar chains of human erythropoietins purified from urine and the culture medium of recombinant Chinese hamster ovary cells. (1988 - Takeuchi M, Takasaki S, Miyazaki H, Kato T, Hoshi S, Kochibe N, Kobata A) / Status : Reviewed
• Comparative structural study of N-linked oligosaccharides of urinary and recombinant erythropoietins. (1988 - Tsuda E, Goto M, Murakami A, Akai K, Ueda M, Kawanishi G, Takahashi N, Sasaki R, Chiba H, Ishihara H) / Status : Reviewed
• Comparative study of the oligosaccharides released from baby hamster kidney cells and their polyoma transformant by hydrazinolysis. (1984 - Yamashita K, Ohkura T, Tachibana Y, Takasaki S, Kobata A) / Status : Reviewed
• The asparagine-linked sugar chains of plasma membrane glycoproteins of K-562 human leukaemic cells: a comparative study with human erythrocytes. (1982 - Yoshima H, Shiraishi N, Matsumoto A, Maeda S, Sugiyama T, Kobata A) / Status : Reviewed
• The application of 500-MHz H-NMR spectroscopy for the structure elucidation of N-acetyllactosamine type asparagine-bound carbohydrate chains of glycoproteins. (1980 - van Halbeek H, Dorland L, Vliegenthart J, Schmid K, Montreuil J, Fournet B, Hull W) / Status : Reviewed
• Determination of the primary structures of 16 asialo-carbohydrate units derived from human plasma alpha 1-acid glycoprotein by 360-MHZ 1H NMR spectroscopy and permethylation analysis. (1978 - Fournet B, Montreuil J, Strecker G, Dorland L, Haverkamp J, Vliegenthart F, Binette J, Schmid K) / Status : Reviewed

Reported glycosite

• 5'-AMP-activated protein kinase catalytic subunit alpha-2 / Homo sapiens
  •        Asn-388
• Alkaline phosphatase, intestinal / Homo sapiens
  •        Undefined site
• Alpha-1-acid glycoprotein 1 / Homo sapiens
  •        Asn-72
• Alpha-1-acid glycoprotein 2 / Homo sapiens
  •        Undefined site
  •        Asn-93
• Alpha-galactosidase A / Homo sapiens
  •        Asn-139
• Alpha-n-acetylglucosaminidase / Homo sapiens
  •        Asn-261
• Aminopeptidase n / Homo sapiens
  •        Asn-818
• Apolipoprotein d / Homo sapiens
  •        Asn-98
• Beta-1,4-galactosyltransferase 3 / Homo sapiens
  •        Asn-166
• Biglycan / Homo sapiens
  •        Asn-270
  •        Asn-311
• Calcium-activated chloride channel regulator 2 / Homo sapiens
  •        Asn-822
• Calponin-3 / Homo sapiens
  •        Asn-240
• Carboxypeptidase D / Homo sapiens
  •        Asn-172
  •        Asn-522
• Cathepsin D / Homo sapiens
  •        Asn-134
• Cation-independent mannose-6-phosphate receptor / Homo sapiens
  •        Asn-435
  •        Asn-871
  •        Asn-1246
  •        Asn-2136
• CD166 antigen / Homo sapiens
  •        Asn-91
  •        Asn-167
  •        Asn-306
• CD276 antigen / Homo sapiens
  •        Asn-91
  •        Asn-215
• CD44 antigen / Homo sapiens
  •        Asn-57
• CD59 glycoprotein / Homo sapiens
  •        Asn-43
• Choline transporter-like protein 2 / Homo sapiens
  •        Asn-200
• Clusterin / Homo sapiens
  •        Asn-374
• CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 / Homo sapiens
  •        Asn-201
• Coagulation factor x / Homo sapiens
  •        Asn-221
  •        Asn-231
• Collagen alpha-1(VI) chain / Homo sapiens
  •        Asn-804
• CTP synthase 1 / Homo sapiens
  •        Asn-420
• Desmoglein-2 / Homo sapiens
  •        Asn-309
  •        Asn-462
• Dipeptidyl peptidase 1 / Homo sapiens
  •        Asn-276
• Disintegrin and metalloproteinase domain-containing protein 15 / Homo sapiens
  •        Asn-389
• Ecto-adp-ribosyltransferase 3 / Homo sapiens
  •        Asn-248
• Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
  •        Asn-294
• Epithelial cell adhesion molecule / Homo sapiens
  •        Asn-74
• Equilibrative nucleoside transporter 1 / Homo sapiens
  •        Asn-48
• Erythropoietin / Homo sapiens
  •        Undefined site
• Erythropoietin - bi / Homo sapiens
  •        Undefined site
• Erythropoietin - tetra / Homo sapiens
  •        Undefined site
• Fibromodulin / Homo sapiens
  •        Asn-166
• Fibronectin / Homo sapiens
  •        Asn-528
  •        Asn-542
• Folate receptor alpha / Homo sapiens
  •        Asn-69
  •        Asn-161
• Gamma-glutamyltranspeptidase 1 / Homo sapiens
  •        Asn-120
• Golgi apparatus protein 1 / Homo sapiens
  •        Asn-165
  •        Asn-210
• Haptoglobin / Homo sapiens
  •        Asn-184
  •        Asn-241
• Hemopexin / Homo sapiens
  •        Asn-187
• Inactive tyrosine-protein kinase 7 / Homo sapiens
  •        Asn-405
• Inositol monophosphatase 3 / Homo sapiens
  •        Asn-259
• Integrin alpha-6 / Homo sapiens
  •        Asn-770
• Integrin alpha-L / Homo sapiens
  •        Asn-89
• Integrin beta-1 / Homo sapiens
  •        Asn-669
• Intercellular adhesion molecule-3 (CD50) / Homo sapiens
  •        Undefined site
• Interferon gamma / Homo sapiens
  •        Undefined site
• Keratin, type i cytoskeletal 18 / Homo sapiens
  •        Asn-423
• Kininogen-1 / Homo sapiens
  •        Asn-169
• Laminin subunit alpha-5 / Homo sapiens
  •        Asn-2707
• Laminin subunit gamma-1 / Homo sapiens
  •        Asn-1241
• Latent transforming growth factor beta binding protein 1 / Homo sapiens
  •        Asn-1366
• Leucyl-cystinyl aminopeptidase / Homo sapiens
  •        Asn-834
• Low-density lipoprotein receptor / Homo sapiens
  •        Asn-657
• Lysosomal acid phosphatase / Homo sapiens
  •        Asn-133
• Lysosome membrane protein 2 / Homo sapiens
  •        Asn-304
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-84
  •        Asn-249
  •        Asn-261
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-58
  •        Asn-123
  •        Asn-257
  •        Asn-275
  •        Asn-356
• Myelin protein P0 / Homo sapiens
  •        Asn-122
• Nectin-1 / Homo sapiens
  •        Asn-297
• Neuroendocrine convertase 2 / Homo sapiens
  •        Asn-524
• Osteopetrosis-associated transmembrane protein 1 / Homo sapiens
  •        Asn-128
• Plasma alpha-L-fucosidase / Homo sapiens
  •        Asn-377
• Podocalyxin / Homo sapiens
  •        Asn-360
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-469
• Prolactin-inducible protein / Homo sapiens
  •        Asn-105
• Prolargin / Homo sapiens
  •        Asn-124
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
  •        Asn-2127
  •        Asn-3662
• Prorenin / Homo sapiens
  •        Undefined site
• Prosaposin / Homo sapiens
  •        Undefined site
  •        Asn-101
  •        Asn-215
  •        Asn-332
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-78
• Protein CASC4 / Homo sapiens
  •        Asn-150
• Protein GPR107 / Homo sapiens
  •        Asn-169
• Protein tweety homolog 3 / Homo sapiens
  •        Asn-144
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens
  •        Undefined site
• Recombinant mature angiotensin-converting enzyme 2 - DRAFT DATA / Homo sapiens
  •        Asn-432
• Recombinant plasminogen - [r580s] / Homo sapiens
  •        Undefined site
• Sortilin / Homo sapiens
  •        Asn-98
  •        Asn-274
• Sparc / Homo sapiens
  •        Asn-116
• Tenascin / Homo sapiens
  •        Asn-1809
• Thrombospondin-1 / Homo sapiens
  •        Asn-360
• Thrombospondin-3 / Homo sapiens
  •        Asn-407
• Transferrin receptor protein 1 / Homo sapiens
  •        Asn-251
• Transmembrane 9 superfamily member 3 / Homo sapiens
  •        Asn-174
• Transmembrane glycoprotein NMB / Homo sapiens
  •        Asn-249
• UDP-glucose:glycoprotein glucosyltransferase 2 / Homo sapiens
  •        Asn-920
• Uncharacterized protein from Fluid / Homo sapiens
  •        Undefined site
• Uromodulin / Homo sapiens
  •        Asn-232
• Von willebrand factor / Homo sapiens
  •        Undefined site
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-128
• Alpha-1-acid glycoprotein / Bos taurus
  •        Undefined site
• Platelet glycoprotein IV / Bos taurus
  •        Undefined site
• Alpha-1-acid glycoprotein / Canis familiaris
  •        Undefined site
• Lysosome-associated membrane glycoprotein 1 / Mus musculus
  •        Asn-177
• Major urinary protein / Mus musculus
  •        Undefined site
• Neuronal cell adhesion molecule / Mus musculus
  •        Asn-613
• Serotransferrin / Mus musculus
  •        Undefined site
• Sodium/potassium-transporting ATPase subunit beta-3 / Mus musculus
  •        Asn-124
• Alpha-1-acid glycoprotein / Ovis aries
  •        Undefined site
• Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
  •        Undefined site
• Ovalbumin (hi) / Columba livia
  •        Undefined site
• Ovalbumin (lo) / Columba livia
  •        Undefined site
• Ovomucoid / Columba livia
  •        Undefined site
• Ovotransferrin / Columba livia
  •        Undefined site
• Recombinant Spike glycoprotein (FreeStyle 293-F) - DRAFT DATA / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-149
• Recombinant Spike glycoprotein (HEK293) - DRAFT DATA / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-17
  •        Asn-122
  •        Asn-149
  •        Asn-165
  •        Asn-234
  •        Asn-282
  •        Asn-331
  •        Asn-657
  •        Asn-717
  •        Asn-801
  •        Asn-1098
  •        Asn-1159
  •        Asn-1174

Mass spectrometry observed peptide

• MFVFLVLLPLVSSQCVNLTTRTQL (24aa)
  •    P0DTC2    Asn-17
• TAVNCSSDFDACIITK (16aa)
  •    P13987    Asn-43
• IDMSQNVSIVTAEISK (16aa)
  •    Q99808    Asn-48
• AFNSTLPTMAQMEK (14aa)
  •    P16070    Asn-57
• YETTNK (6aa)
  •    P13473    Asn-58
• NACCSTNTSQEAHK (14aa)
  •    P15328    Asn-69
• AEMNGSK (7aa)
  •    P16422    Asn-74
• SVVAPATDGGINITSTFIR (19aa)
  •    P41222    Asn-78
• ENTSDPSIVIAFGR (14aa)
  •    P11279    Asn-84
• SSCGKENTSDPSIVIAFGR (19aa)
  •    P11279    Asn-84
• QNQCFYNSSYLNVQR (15aa)
  •    P19652    Asn-93
• ADGTVNQIEGEATPVNLTEPAK (22aa)
  •    P05090    Asn-98
• GSNYTSK (7aa)
  •    P20701    Asn-89
• INISENYTISISNAR (15aa)
  •    Q13740    Asn-91
• QIVHSFAEGQDQGSAYANR (19aa)
  •    Q5ZPR3    Asn-91
• IANNTHQHVFDDIR (14aa)
  •    Q99523    Asn-98
• TCDWIPKPNMSASCK (15aa)
  •    P07602    Asn-101
• TFYWDFYTNR (10aa)
  •    P12273    Asn-105
• VCSNDNK (7aa)
  •    P09486    Asn-116
• IAFATMFNSSEQSQK (15aa)
  •    P19440    Asn-120
• DGSIVIHNLDYSDNGTFTCDVK (22aa)
  •    P25189    Asn-122
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122
• AASTYSIDSVSFSYNTGDNTTFPDAEDK (28aa)
  •    P13473    Asn-123
• SIDSVSFSYNTGDNTTFPDAEDK (23aa)
  •    P13473    Asn-123
• IHYLYLQNNFITELPVESFQNATGLR (26aa)
  •    P51888    Asn-124
• LVEDLESFLKPYSVEEQKNLTSCPDGAPFIQHGPDYR (37aa)
  •    P97370    Asn-124
• FGCEIENNR (9aa)
  •    P25311    Asn-128
• MDNISR (6aa)
  •    Q86WC4    Asn-128
• FNPNISWQPIPVHTVPITEDR (21aa)
  •    P11117    Asn-133
• NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa)
  •    P07339    Asn-134
• IGIYADVGNK (10aa)
  •    P06280    Asn-139
• VWDTAVGINHTAEPSIQTIER (21aa)
  •    Q9C0H2    Asn-144
• HKNNKSW (7aa)
  •    P0DTC2    Asn-149
• YHKNNKSWMESEF (13aa)
  •    P0DTC2    Asn-149
• NNKSWMESEFRVYSSANNCTFEYVS (25aa)
  •    P0DTC2    Asn-165
• VYYHKNNK (8aa)
  •    P0DTC2    Asn-149
• NNTYLVK (7aa)
  •    Q6P4E1    Asn-150
• LNLTTDPK (8aa)
  •    Q92896    Asn-165
• GWNWTSGFNK (10aa)
  •    P15328    Asn-161
• VYSSANNCTFEY (12aa)
  •    P0DTC2    Asn-165
• VYSSANNCTFE (11aa)
  •    P0DTC2    Asn-165
• IYIDHNNITR (10aa)
  •    Q06828    Asn-166
• GIYVIHQAGNGTFNR (15aa)
  •    O60512    Asn-166
• IGDCISEDSYPDGNITWYR (19aa)
  •    Q13740    Asn-167
• VIGQSQEPNVNPASAGNQTQK (21aa)
  •    Q5VW38    Asn-169
• IINTTDVYIIPSINPDGFER (20aa)
  •    O75976    Asn-172
• IVDVNITSEGK (11aa)
  •    Q9HD45    Asn-174
• DATIQAYLSSGNFSKEETHCTQDGPSPTTGPPSPSPPLVPTNPTVSK (47aa)
  •    P11438    Asn-177
• KNITDIVEGAK (11aa)
  •    Q8IWA5    Asn-200
• EIGDNVSMIIVPFK (14aa)
  •    Q11201    Asn-201
• GNITEYQCHQYITK (14aa)
  •    Q92896    Asn-210
• VVIGANGTYSCIVR (14aa)
  •    Q5ZPR3    Asn-215
• TNSTFVQAIVEHVKEECDR (19aa)
  •    P07602    Asn-215
• PINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHR (38aa)
  •    P0DTC2    Asn-234
• LVDLPIGINITRFQTLLALHR (21aa)
  •    P0DTC2    Asn-234
• DLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQ (57aa)
  •    P0DTC2    Asn-234
• ITIQPVDNSTISIQMGTNK (19aa)
  •    Q15417    Asn-240
• VVLHPNYSQVDIGLIK (16aa)
  •    P00738    Asn-241
• ITIIPINEVFQVSQEGAGNNIIIQSINK (28aa)
  •    Q13508    Asn-248
• KDNTTVTR (8aa)
  •    P11279    Asn-249
• RNSSDETFLK (10aa)
  •    Q14956    Asn-249
• KDFEDIYTPVNGSIVIVR (18aa)
  •    P02786    Asn-251
• VASVININPNTTHSTGSCR (19aa)
  •    P13473    Asn-257
• QVAIQTFGNQTTIIPAGGAGYK (22aa)
  •    Q9NX62    Asn-259
• VFPQVNVTK (9aa)
  •    P54802    Asn-261
• IININPNK (8aa)
  •    P11279    Asn-261
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270
• WGSDNTIFFTTYANGSCK (18aa)
  •    Q99523    Asn-274
• LNSSTIK (7aa)
  •    P13473    Asn-275
• IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
  •    P53634    Asn-276
• YNENGTITDAVDCALDPLSETK (22aa)
  •    P0DTC2    Asn-282
• NGTITDAVDCALDPLSE (17aa)
  •    P0DTC2    Asn-282
• GFSTQVLLGDVYQSPCTMAQRPQNFNSSAR (30aa)
  •    Q9Y5L3    Asn-294
• GVEAQNR (7aa)
  •    Q15223    Asn-297
• YKVPAEILANTSDNAGFCIPEGN (23aa)
  •    Q14108    Asn-304
• NATGDYK (7aa)
  •    Q13740    Asn-306
• VFDADEIGSDNWLANFT (17aa)
  •    Q14126    Asn-309
• IIQVVYIHSNNITK (14aa)
  •    P21810    Asn-311
• GIYQTSNFRVQPTESIVRFPNITNLCPFGEVFN (33aa)
  •    P0DTC2    Asn-331
• IIDNNKTEK (9aa)
  •    P07602    Asn-332
• VQPFNVTQGK (10aa)
  •    P13473    Asn-356
• KVSCPIMPCSNATVPDGECCPR (22aa)
  •    P07996    Asn-360
• VSCPIMPCSNATVPDGECCPR (21aa)
  •    P07996    Asn-360
• QIVINITGNTICAGGASDEK (20aa)
  •    O00592    Asn-360
• IANITQGEDQYYIR (14aa)
  •    P10909    Asn-374
• SQNDTVTPDVWYTSKPK (17aa)
  •    Q9BTY2    Asn-377
• CPLDALNTTK (10aa)
  •    P54646    Asn-388
• TCIMEASTDFLPGLNFSNCSR (21aa)
  •    Q13444    Asn-389
• RQDVNITVATVPSWIK (16aa)
  •    Q13308    Asn-405
• IGFIGNQSQGCIPAR (15aa)
  •    P49746    Asn-407
• NVLGWQDANSTEFDPTTSHPVVVDMPEHNPGQMGGTMR (38aa)
  •    P17812    Asn-420
• VVSETNDTK (9aa)
  •    P05783    Asn-423
• SPDFQEDNETEINF (14aa)
  •    Q9BYF1    Asn-432
• MSVINFECNK (10aa)
  •    P11717    Asn-435
• YVQNGTYTVK (10aa)
  •    Q14126    Asn-462
• VPGNVTAVIGETIK (14aa)
  •    P01833    Asn-469
• FANEYPNITR (10aa)
  •    O75976    Asn-522
• NMTSPMGTK (9aa)
  •    P16519    Asn-524
• DQCIVDDITYNVNDTFHK (18aa)
  •    P02751    Asn-528
• RHEEGHMINCTCFGQGR (17aa)
  •    P02751    Asn-542
• FSTDKDHLVVSDVKDDDGGTYTCTANTTLDSASASAVLR (39aa)
  •    Q810U4    Asn-613
• ITGSDVNIIAENIISPEDMVIFHNITQPR (29aa)
  •    P01130    Asn-657
• AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
  •    P0DTC2    Asn-657
• DTCTQECSYFNITK (14aa)
  •    P05556    Asn-669
• IIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSM (40aa)
  •    P0DTC2    Asn-717
• IIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGS (67aa)
  •    P0DTC2    Asn-717
• ANQNGSQADCELGNPFK (17aa)
  •    P23229    Asn-770
• DFGGFNFSQILPDPSK (16aa)
  •    P0DTC2    Asn-801
• NVTAQICIDK (10aa)
  •    P12109    Asn-804
• NATLVNEADK (10aa)
  •    P15144    Asn-818
• SLQNIQDDFNNAILVNTSK (19aa)
  •    Q9UQC9    Asn-822
• SAIIEFACTHNIGNCSTTAMK (21aa)
  •    Q9UIQ6    Asn-834
• TGPVVEDSGSIIIEYVNGSACTTSDGR (27aa)
  •    P11717    Asn-871
• NMSDFIMK (8aa)
  •    Q9NYU1    Asn-920
• EGVFVSNGTHWFVTQR (16aa)
  •    P0DTC2    Asn-1098
• EGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIG (40aa)
  •    P0DTC2    Asn-1098
• NHTSPDVDLGDISGINAS (18aa)
  •    P0DTC2    Asn-1159
• NHTSPDVDLGDISGIN (16aa)
  •    P0DTC2    Asn-1174
• NISQDLEK (8aa)
  •    P11047    Asn-1241
• HGNIYDIKPIGINDTIVSAGEYTYYFR (27aa)
  •    P11717    Asn-1246
• KECYYNINDASICDNVIAPNVTK (23aa)
  •    Q14766    Asn-1366
• GFEESEPVSGSFTTAIDGPSGIVTANITDSEAIAR (35aa)
  •    P24821    Asn-1809
• NATDSVPLR (9aa)
  •    Q07954    Asn-2127
• AACAVKPQEVQMVNGTITNPINGK (24aa)
  •    P11717    Asn-2136
• NASLALSASIGR (12aa)
  •    O15230    Asn-2707
• TCPIDEFQCNNTICKPIAWK (20aa)
  •    Q07954    Asn-3662