taxonomy (2)
protein (8)
source (13)
structure (12)
composition (1)
disease (5)
reference (9)
site (8)
peptide (4)
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Matrix metalloproteinase-9 / Homo sapiens P14780
- Prostaglandin-h2 d-isomerase / Homo sapiens P41222
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Protein AMBP / Homo sapiens P02760
- Unspecified mucin / Homo sapiens
- Uromodulin / Homo sapiens P07911
- Mucin / Macaca radiata
Protein
- Blood Plasma (UBERON_0001969)
- Cervical Mucosa (UBERON_0012248)
- Milk (UBERON_0001913)
- Pulmonary Mucosa
- Seminal Fluid (UBERON_0006530)
- Urine (UBERON_0001088)
- C10 (CVCL_5245)
- LS174T (CVCL_1384)
- LS180 (CVCL_0397)
- LS411N (CVCL_1385)
- SW948 (CVCL_0632)
- T84 (CVCL_0555)
- Neutrophil (CL_0000775)
Source
- N-Linked / Complex / Structure 10920
- O-Linked / Core 1 / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)GalNAc
- O-Linked / Core 1 / Structure 11045
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-?)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-?)[Gal(b1-?)]GlcNAc(b1-?)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-?)GlcNAc(b1-?)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-6)[Fuc(a1-2)[Gal(a1-3)]Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Structure 11046
- O-Linked / Undefined core / NeuAc(?2-3)Gal(?1-?)GlcNAc(?1-3)Gal(?1-3)[Gal(?1-4)GlcNAc(?1-6)]GalNAc+"+ Fuc"
Reported structure
- Bronchiectasis, due to Kartagener's Syndrome
- Cecum adenocarcinoma (DOID:3039)
- Colon adenocarcinoma (DOID:234)
- Multiple myeloma (DOID:9538)
- Prostate cancer (DOID:10283)
Disease
- Colorectal cancer cell lines show striking diversity of their O-glycome reflecting the cellular differentiation phenotype (2021 - Katarina Madunić, Tao Zhang, Oleg A Mayboroda, Stephanie Holst, Kathrin Stavenhagen, Chunsheng Jin, Niclas G Karlsson, Guinevere S M Lageveen-Kammeijer, Manfred Wuhrer) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- O-glycan analysis of natural human neutrophil gelatinase B using a combination of normal phase-HPLC and online tandem mass spectrometry: implications for the domain organization of the enzyme. (2000 - Mattu T, Royle L, Langridge J, Wormald M, Van den Steen P, Van Damme J, Opdenakker G, Harvey D, Dwek R, Rudd P) / Status : Reviewed
- Isolation and structural characterization of novel sialylated oligosaccharide-alditols from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis. (1993 - Klein A, Carnoy C, Lamblin G, Roussel P, van Kuik J, Vliegenthart J) / Status : Reviewed
- Structures of acidic O-linked polylactosaminoglycans on human skim milk mucins. (1990 - Hanisch F, Peter-Katalinic J, Egge H, Dabrowski U, Uhlenbruck G) / Status : Reviewed
- Primary structure of twenty three neutral and monosialylated oligosaccharides O-glycosidically linked to the human secretory immunoglobulin A hinge region determined by a combination of permethylation analysis and 400-MHz 1H-NMR spectroscopy. (1989 - Pierce-Cretel A, Decottignies J, Wieruszeski J, Strecker G, Montreuil J, Spik G) / Status : Reviewed
- Structure of sialyloligosaccharides isolated from bonnet monkey (Macaca radiata) cervical mucus glycoproteins exhibiting multiple blood group activities. (1986 - Nasir-Ud-Din , Jeanloz R, Lamblin G, Roussel P, van Halbeek H, Mutsaers J, Vliegenthart J) / Status : Reviewed
Reference
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
Matrix metalloproteinase-9 / Homo sapiens
- Undefined site
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Protein AMBP / Homo sapiens
-
Unspecified mucin / Homo sapiens
- Undefined site
- Uromodulin / Homo sapiens
-
Mucin / Macaca radiata
- Undefined site
Reported glycosite
- SVVAPATDGGLNLTSTFLRKNQCETR (26aa)
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- CNTAAPMWLNGTHPSSDEGIVSR (23aa)
- YFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCR (36aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 1551.4284)
- Blood Plasma (UBERON_0001969)
- Multiple myeloma (DOID:9538)
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
- O-Linked / Core 1
(avg mass : 1551.4284)
- Pulmonary Mucosa
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 1
(avg mass : 1551.4284)
- LS174T (CVCL_1384)
- LS180 (CVCL_0397)
- T84 (CVCL_0555)
- Colon adenocarcinoma (DOID:234)
-
- O-Linked / Core 2
(avg mass : 1551.4284)
- Milk (UBERON_0001913)
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1551.4284)
- Neutrophil (CL_0000775)
-
Matrix metalloproteinase-9 / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1551.4284)
- Milk (UBERON_0001913)
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1551.4284)
- Milk (UBERON_0001913)
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1551.4284)
- Milk (UBERON_0001913)
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1551.4284)
- Milk (UBERON_0001913)
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1551.4284)
- Cervical Mucosa (UBERON_0012248)
-
Mucin / Macaca radiata
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1551.4284)
-
- O-Linked / Undefined core
(avg mass : 1551.4284)
- Milk (UBERON_0001913)
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- Hex:3 HexNAc:3 dHex:1 NeuAc:1 / N-Linked
(avg mass : 1551.4284)
- Seminal Fluid (UBERON_0006530)
- N-Linked / Complex / Structure 10920
- Prostate-specific antigen (psa-1) / Homo sapiens
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
-
- Hex:3 HexNAc:3 dHex:1 NeuAc:1 / O-Linked
(avg mass : 1551.4284)
- Urine (UBERON_0001088)
- SW948 (CVCL_0632)
- O-Linked / Core 1 / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)GalNAc
- O-Linked / Core 1 / Structure 11045
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-?)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-?)[Gal(b1-?)]GlcNAc(b1-?)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-?)GlcNAc(b1-?)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-6)[Fuc(a1-2)[Gal(a1-3)]Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Structure 11046
- O-Linked / Undefined core / NeuAc(?2-3)Gal(?1-?)GlcNAc(?1-3)Gal(?1-3)[Gal(?1-4)GlcNAc(?1-6)]GalNAc+"+ Fuc"
- Colorectal cancer cell lines show striking diversity of their O-glycome reflecting the cellular differentiation phenotype (2021 - Katarina Madunić, Tao Zhang, Oleg A Mayboroda, Stephanie Holst, Kathrin Stavenhagen, Chunsheng Jin, Niclas G Karlsson, Guinevere S M Lageveen-Kammeijer, Manfred Wuhrer) / Status : Reviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Protein AMBP / Homo sapiens
- Uromodulin / Homo sapiens
- SVVAPATDGGLNLTSTFLRKNQCETR (26aa)
- CNTAAPMWLNGTHPSSDEGIVSR (23aa)
- YFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCR (36aa)
Source
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:3 HexNAc:3 dHex:1 NeuAc:1 / O-Linked
(avg mass : 1551.4284)
Source
Suggested structure
Reported glycosite
Mass spectrometry observed peptide
- Hex:3 HexNAc:3 dHex:1 NeuAc:1 / N-Linked
(avg mass : 1551.4284)
Source
Reported glycosite
- O-Linked / Undefined core
(avg mass : 1551.4284)
Reported glycosite
- O-Linked / Core 2
(avg mass : 1551.4284)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1551.4284)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1551.4284)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1551.4284)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1551.4284)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1551.4284)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1551.4284)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1551.4284)
Source
Disease
Reported glycosite
- O-Linked / Core 1
(avg mass : 1551.4284)
Source
Reported glycosite
- O-Linked / Core 1
(avg mass : 1551.4284)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1551.4284)