Hex:3 HexNAc:3 dHex:1 NeuAc:1

Taxonomy

• Homo sapiens (Human)
• Macaca radiata (Bonnet macaque)

Protein

• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Matrix metalloproteinase-9 / Homo sapiens    P14780
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• Protein AMBP / Homo sapiens    P02760
• Unspecified mucin / Homo sapiens    
• Uromodulin / Homo sapiens    P07911
• Mucin / Macaca radiata    

Source

• Blood Plasma (UBERON_0001969)  
• Cervical Mucosa (UBERON_0012248)  
• Milk (UBERON_0001913)  
• Pulmonary Mucosa  
• Seminal Fluid (UBERON_0006530)  
• Urine (UBERON_0001088)  
• C10 (CVCL_5245)  
• LS174T (CVCL_1384)  
• LS180 (CVCL_0397)  
• LS411N (CVCL_1385)  
• SW948 (CVCL_0632)  
• T84 (CVCL_0555)  
• Neutrophil (CL_0000775)  

Reported structure

• N-Linked / Complex / Structure 10920
• O-Linked / Core 1 / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)GalNAc
• O-Linked / Core 1 / Structure 11045
• O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
• O-Linked / Core 2 / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-?)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
• O-Linked / Core 2 / Fuc(a1-?)[Gal(b1-?)]GlcNAc(b1-?)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
• O-Linked / Core 2 / Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
• O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
• O-Linked / Core 2 / Gal(b1-?)GlcNAc(b1-?)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
• O-Linked / Core 2 / GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-6)[Fuc(a1-2)[Gal(a1-3)]Gal(b1-3)]GalNAc
• O-Linked / Core 2 / Structure 11046
• O-Linked / Undefined core / NeuAc(?2-3)Gal(?1-?)GlcNAc(?1-3)Gal(?1-3)[Gal(?1-4)GlcNAc(?1-6)]GalNAc+"+ Fuc"

Composition

• Hex:3 HexNAc:3 dHex:1 NeuAc:1 (avg mass : 1551.4284 )

Disease

• Bronchiectasis, due to Kartagener's Syndrome
• Cecum adenocarcinoma (DOID:3039)
• Colon adenocarcinoma (DOID:234)
• Multiple myeloma (DOID:9538)
• Prostate cancer (DOID:10283)

Reference

• Colorectal cancer cell lines show striking diversity of their O-glycome reflecting the cellular differentiation phenotype (2021 - Katarina Madunić, Tao Zhang, Oleg A Mayboroda, Stephanie Holst, Kathrin Stavenhagen, Chunsheng Jin, Niclas G Karlsson, Guinevere S M Lageveen-Kammeijer, Manfred Wuhrer) / Status : Reviewed
• A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
• O-glycan analysis of natural human neutrophil gelatinase B using a combination of normal phase-HPLC and online tandem mass spectrometry: implications for the domain organization of the enzyme. (2000 - Mattu T, Royle L, Langridge J, Wormald M, Van den Steen P, Van Damme J, Opdenakker G, Harvey D, Dwek R, Rudd P) / Status : Reviewed
• Isolation and structural characterization of novel sialylated oligosaccharide-alditols from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis. (1993 - Klein A, Carnoy C, Lamblin G, Roussel P, van Kuik J, Vliegenthart J) / Status : Reviewed
• Structures of acidic O-linked polylactosaminoglycans on human skim milk mucins. (1990 - Hanisch F, Peter-Katalinic J, Egge H, Dabrowski U, Uhlenbruck G) / Status : Reviewed
• Primary structure of twenty three neutral and monosialylated oligosaccharides O-glycosidically linked to the human secretory immunoglobulin A hinge region determined by a combination of permethylation analysis and 400-MHz 1H-NMR spectroscopy. (1989 - Pierce-Cretel A, Decottignies J, Wieruszeski J, Strecker G, Montreuil J, Spik G) / Status : Reviewed
• Structure of sialyloligosaccharides isolated from bonnet monkey (Macaca radiata) cervical mucus glycoproteins exhibiting multiple blood group activities. (1986 - Nasir-Ud-Din , Jeanloz R, Lamblin G, Roussel P, van Halbeek H, Mutsaers J, Vliegenthart J) / Status : Reviewed

Reported glycosite

• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Undefined site
• Matrix metalloproteinase-9 / Homo sapiens
  •        Undefined site
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Ser-67
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• Protein AMBP / Homo sapiens
  •        Thr-252
• Unspecified mucin / Homo sapiens
  •        Undefined site
• Uromodulin / Homo sapiens
  •        Thr-225
• Mucin / Macaca radiata
  •        Undefined site

Mass spectrometry observed peptide

• SVVAPATDGGLNLTSTFLRKNQCETR (26aa)
  •    P41222    Ser-67     Prostaglandin-h2 d-isomerase / Homo sapiens
• AVCGGVLVHPQWVLTAAHCIRNK (23aa)
  •    P07288    Asn-69     Prostate-specific antigen (psa-1) / Homo sapiens
• CNTAAPMWLNGTHPSSDEGIVSR (23aa)
  •    P07911    Thr-225     Uromodulin / Homo sapiens
• YFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCR (36aa)
  •    P02760    Thr-252     Protein AMBP / Homo sapiens