GlyConnect

taxonomy (2) protein (7) source (5) structure (9) composition (1) disease (2) reference (6) site (7) peptide (3)

Taxonomy

Homo sapiens (Human)
Macaca radiata (Bonnet macaque)

Protein

Source

Reported structure

Composition

Hex:3 HexNAc:3 dHex:1 NeuAc:1 (avg mass : 1551.4284 )

Disease

Reference

Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
O-glycan analysis of natural human neutrophil gelatinase B using a combination of normal phase-HPLC and online tandem mass spectrometry: implications for the domain organization of the enzyme. (2000 - Mattu T, Royle L, Langridge J, Wormald M, Van den Steen P, Van Damme J, Opdenakker G, Harvey D, Dwek R, Rudd P) / Status : Reviewed
Isolation and structural characterization of novel sialylated oligosaccharide-alditols from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis. (1993 - Klein A, Carnoy C, Lamblin G, Roussel P, van Kuik J, Vliegenthart J) / Status : Reviewed
Structures of acidic O-linked polylactosaminoglycans on human skim milk mucins. (1990 - Hanisch F, Peter-Katalinic J, Egge H, Dabrowski U, Uhlenbruck G) / Status : Reviewed
Primary structure of twenty three neutral and monosialylated oligosaccharides O-glycosidically linked to the human secretory immunoglobulin A hinge region determined by a combination of permethylation analysis and 400-MHz 1H-NMR spectroscopy. (1989 - Pierce-Cretel A, Decottignies J, Wieruszeski J, Strecker G, Montreuil J, Spik G) / Status : Reviewed
Structure of sialyloligosaccharides isolated from bonnet monkey (Macaca radiata) cervical mucus glycoproteins exhibiting multiple blood group activities. (1986 - Nasir-Ud-Din , Jeanloz R, Lamblin G, Roussel P, van Halbeek H, Mutsaers J, Vliegenthart J) / Status : Reviewed

Reported glycosite

Immunoglobulin alpha (secretory) / Homo sapiens
- Undefined site
Matrix metalloproteinase-9 / Homo sapiens
- Undefined site
Prostaglandin-h2 d-isomerase / Homo sapiens
- Ser-67
Protein AMBP / Homo sapiens
- Thr-252
Unspecified mucin / Homo sapiens
- Undefined site
Uromodulin / Homo sapiens
- Thr-225
Mucin / Macaca radiata
- Undefined site

Mass spectrometry observed peptide

SVVAPATDGGLNLTSTFLRKNQCETR (26aa)
- P41222 Ser-67
CNTAAPMWLNGTHPSSDEGIVSR (23aa)
- P07911 Thr-225
YFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCR (36aa)
- P02760 Thr-252

- O-Linked / Core 1 (avg mass : 1551.4284)
- O-Linked / Core 2 (avg mass : 1551.4284)
- O-Linked / Core 2 (avg mass : 1551.4284)
- O-Linked / Core 2 (avg mass : 1551.4284)
- O-Linked / Core 2 (avg mass : 1551.4284)
- O-Linked / Core 2 (avg mass : 1551.4284)
- O-Linked / Core 2 (avg mass : 1551.4284)
- O-Linked / Core 2 (avg mass : 1551.4284)
- O-Linked / Undefined core (avg mass : 1551.4284)

- Hex:3 HexNAc:3 dHex:1 NeuAc:1 / O-Linked (avg mass : 1551.4284)