taxonomy (6)
protein (76)
source (15)
structure (13)
composition (1)
disease (5)
reference (17)
site (86)
peptide (79)
- Homo sapiens (Human)
- Rattus norvegicus (Norway rat)
- Gallus gallus (Chicken)
- Torpedo californica (Pacific electric ray)
- Human immunodeficiency virus type 1 (lw12.3 isolate)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Agrin / Homo sapiens O00468
- Alpha-1-antichymotrypsin / Homo sapiens P01011
- Alpha-1-antitrypsin / Homo sapiens P01009
- Alpha-2-macroglobulin / Homo sapiens P01023
- Alpha-n-acetylgalactosaminidase / Homo sapiens P17050
- Alpha-S1-casein / Homo sapiens P47710
- Anoctamin-6 / Homo sapiens Q4KMQ2
- Apolipoprotein B-100 / Homo sapiens P04114
- Apolipoprotein D / Homo sapiens P05090
- Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens P98160
- Beta-2-glycoprotein 1 / Homo sapiens P02749
- Biglycan / Homo sapiens P21810
- Calcium-activated potassium channel subunit alpha-1 / Homo sapiens Q12791
- Carnitine O-acetyltransferase / Homo sapiens P43155
- CD97 antigen / Homo sapiens P48960
- Choriogonadotropin - alpha and beta chains / Homo sapiens P0DN86 P01215
- Clusterin / Homo sapiens P10909
- Coagulation factor V / Homo sapiens P12259
- Coagulation factor XIII B chain / Homo sapiens P05160
- Complement c1r subcomponent / Homo sapiens P00736
- Complement c3 / Homo sapiens P01024
- Contactin-4 / Homo sapiens Q8IWV2
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens P04844
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens Q9Y5L3
- Ephrin type-B receptor 3 / Homo sapiens P54753
- Ephrin-A3 / Homo sapiens P52797
- Epidermal growth factor receptor / Homo sapiens P00533
- Fibrinogen alpha chain / Homo sapiens P02671
- Fibronectin / Homo sapiens P02751
- Follistatin-related protein 1 / Homo sapiens Q12841
- Fractalkine / Homo sapiens P78423
- Golgi apparatus protein 1 / Homo sapiens Q92896
- Hemopexin / Homo sapiens P02790
- Heparin cofactor 2 / Homo sapiens P05546
- Immunoglobulin superfamily member 5 / Homo sapiens Q9NSI5
- Inter-alpha-trypsin inhibitor heavy chain H3 / Homo sapiens Q06033
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens Q14624
- Inter-alpha-trypsin inhibitor heavy chain H5 / Homo sapiens Q86UX2
- Interleukin-1 receptor accessory protein / Homo sapiens Q9NPH3
- Laminin subunit alpha-5 / Homo sapiens O15230
- Leucine-rich alpha-2-glycoprotein / Homo sapiens P02750
- Leucine-rich repeat-containing protein 4 / Homo sapiens Q9HBW1
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Major facilitator superfamily domain-containing protein 6 / Homo sapiens Q6ZSS7
- Myelin protein zero-like protein 1 / Homo sapiens O95297
- N-acetylglucosamine-6-sulfatase / Homo sapiens P15586
- Neural cell adhesion molecule L1 / Homo sapiens P32004
- Neuroplastin / Homo sapiens Q9Y639
- Phosphatidylinositol-glycan-specific phospholipase D / Homo sapiens P80108
- Plasma kallikrein / Homo sapiens P03952
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Probable lysosomal cobalamin transporter / Homo sapiens Q9NUN5
- Prolactin-inducible protein / Homo sapiens P12273
- Prothrombin / Homo sapiens P00734
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens P08575
- Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens Q15262
- Secretogranin-3 / Homo sapiens Q8WXD2
- Serotransferrin / Homo sapiens P02787
- Serum paraoxonase/arylesterase 1 / Homo sapiens P27169
- Serum paraoxonase/arylesterase 2 / Homo sapiens Q15165
- Thrombospondin-1 / Homo sapiens P07996
- Tissue alpha-L-fucosidase / Homo sapiens P04066
- Transmembrane 9 superfamily member 3 / Homo sapiens Q9HD45
- Transmembrane emp24 domain-containing protein 7 / Homo sapiens Q9Y3B3
- Villin-1 / Homo sapiens P09327
- Vitronectin / Homo sapiens P04004
- VWFA and cache domain-containing protein 1 / Homo sapiens Q5VU97
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Uncharacterized protein / Rattus norvegicus
- Uncharacterized protein / Rattus norvegicus
- Uncharacterized protein / Rattus norvegicus
- Riboflavin-binding protein / Gallus gallus P02752
- Acetylcholine receptor protein / Torpedo californica P02718 P02712 P02710 P02714
- Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate) Q70626
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Blood Plasma (UBERON_0001969)
- Cerebrospinal Fluid (UBERON_0001359)
- Colon (UBERON_0001155)
- Electric Organ (UBERON_0006869)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO-DG44 (CVCL_7180)
- Placenta (UBERON_0001987) JEG-3 (CVCL_0363) Epithelium (CL_0002577)
- Prefrontal Cortex (UBERON:0000451)
- 3Y1-B clone 1 (CVCL_4563)
- FreeStyle 293-F (CVCL_D603)
- H9 (CVCL_1240) Lymphocyte (CL_0000542)
- HEK293 (CVCL_0045)
- Egg Cell
- Leukocyte (CL_0000738)
Source
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-?)[GlcNAc(b1-?)]Man(a1-6)]Man(a1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x Gal(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x Gal(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x Gal(b1-4)"
- N-Linked / Complex / Structure 9463
- N-Linked / Complex / Structure 10011
- N-Linked / Complex / Structure 11157
- N-Linked / Complex / Structure 11547
- N-Linked / Complex / Structure 11602
- N-Linked / Complex / Structure 11862
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
Reported structure
- Hex:6 HexNAc:6 (avg mass : 2210.0397 )
Composition
- Cancer, breast (DOID:1612)
- Choriocarcinoma (DOID:3594)
- COVID-19 (DOID:0080600)
- Leukemia, Acute lymphoblastic (DOID:9952)
- Schizophrenia (DOID:5419)
Disease
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Comprehensive N- and O-glycosylation mapping of human coagulation factor V. (2020 - Ma C, Liu D, Li D, Zhang J, Xu XQ, Zhu H, Wan XF, Miao CH, Konkle BA, Onigman P, Xiao W, Li L) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Spatial and temporal diversity of glycome expression in mammalian brain (2020 - Lee J, Ha S, Kim M, Kim SW, Yun J, Ozcan S, Hwang H, Ji IJ, Yin D, Webster MJ, Shannon Weickert C, Kim JH, Yoo JS, Grimm R, Bahn S, Shin HS, An HJ) / Status : Reviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Identification of N-glycosylation changes in the CSF and serum in patients with schizophrenia (2010 - Stanta JL, Saldova R, Struwe WB, Byrne JC, Leweke FM, Rothermund M, Rahmoune H, Levin Y, Guest PC, Bahn S, Rudd PM) / Status : Reviewed
- Abnormal biantennary sugar chains are expressed in human chorionic gonadotropin produced in the choriocarcinoma cell line, JEG-3. (2004 - Takamatsu S, Katsumata T, Inoue N, Watanabe T, Fujibayashi Y, Takeuchi M) / Status : Reviewed
- Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- Structural study of the O-linked sugar chains of human leukocyte tyrosine phosphatase CD45. (1998 - Furukawa K, Funakoshi Y, Autero M, Horejsi V, Kobata A, Gahmberg C) / Status : Reviewed
- Structural study of the sugar chains of human leukocyte common antigen CD45. (1993 - Sato T, Furukawa K, Autero M, Gahmberg C, Kobata A) / Status : Reviewed
- Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
- Diversity of oligosaccharide structures on the envelope glycoprotein gp 120 of human immunodeficiency virus 1 from the lymphoblastoid cell line H9. Presence of complex-type oligosaccharides with bisecting N-acetylglucosamine residues. (1990 - Mizuochi T, Matthews T, Kato M, Hamako J, Titani K, Solomon J, Feizi T) / Status : Reviewed
- Transfection with fragments of the adenovirus 12 gene induces tumorigenicity-associated alteration of N-linked sugar chains in rat cells. (1990 - Hiraizumi S, Takasaki S, Shiroki K, Kochibe N, Kobata A) / Status : Reviewed
Reference
- Agrin / Homo sapiens
- Alpha-1-antichymotrypsin / Homo sapiens
- Alpha-1-antitrypsin / Homo sapiens
- Alpha-2-macroglobulin / Homo sapiens
-
Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
- Alpha-S1-casein / Homo sapiens
- Anoctamin-6 / Homo sapiens
- Apolipoprotein B-100 / Homo sapiens
- Apolipoprotein D / Homo sapiens
- Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
- Beta-2-glycoprotein 1 / Homo sapiens
- Biglycan / Homo sapiens
- Calcium-activated potassium channel subunit alpha-1 / Homo sapiens
- Carnitine O-acetyltransferase / Homo sapiens
- CD97 antigen / Homo sapiens
-
Choriogonadotropin - alpha and beta chains / Homo sapiens
- Undefined site
- Clusterin / Homo sapiens
- Coagulation factor V / Homo sapiens
- Coagulation factor XIII B chain / Homo sapiens
- Complement c1r subcomponent / Homo sapiens
- Complement c3 / Homo sapiens
- Contactin-4 / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
- Ephrin type-B receptor 3 / Homo sapiens
- Ephrin-A3 / Homo sapiens
- Epidermal growth factor receptor / Homo sapiens
- Fibrinogen alpha chain / Homo sapiens
- Fibronectin / Homo sapiens
- Follistatin-related protein 1 / Homo sapiens
- Fractalkine / Homo sapiens
- Golgi apparatus protein 1 / Homo sapiens
- Hemopexin / Homo sapiens
- Heparin cofactor 2 / Homo sapiens
- Immunoglobulin superfamily member 5 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain H3 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain H5 / Homo sapiens
- Interleukin-1 receptor accessory protein / Homo sapiens
- Laminin subunit alpha-5 / Homo sapiens
- Leucine-rich alpha-2-glycoprotein / Homo sapiens
- Leucine-rich repeat-containing protein 4 / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Major facilitator superfamily domain-containing protein 6 / Homo sapiens
- Myelin protein zero-like protein 1 / Homo sapiens
- N-acetylglucosamine-6-sulfatase / Homo sapiens
- Neural cell adhesion molecule L1 / Homo sapiens
- Neuroplastin / Homo sapiens
- Phosphatidylinositol-glycan-specific phospholipase D / Homo sapiens
- Plasma kallikrein / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Probable lysosomal cobalamin transporter / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prothrombin / Homo sapiens
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
- Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
- Secretogranin-3 / Homo sapiens
- Serotransferrin / Homo sapiens
- Serum paraoxonase/arylesterase 1 / Homo sapiens
- Serum paraoxonase/arylesterase 2 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Tissue alpha-L-fucosidase / Homo sapiens
- Transmembrane 9 superfamily member 3 / Homo sapiens
- Transmembrane emp24 domain-containing protein 7 / Homo sapiens
- Villin-1 / Homo sapiens
- Vitronectin / Homo sapiens
- VWFA and cache domain-containing protein 1 / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Acetylcholine receptor protein / Torpedo californica
- Undefined site
-
Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate)
- Undefined site
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- CNITCSK (7aa)
- EIFVANGTQGK (11aa)
- FSNVTWF (7aa)
- CIQANYSIMENGK (13aa)
- KDTRNESTQNCVVAEPEKM (19aa)
- FHAIHVSGTNGTKRF (15aa)
- NQNGTFK (7aa)
- AFITNF (6aa)
- AIVNFTR (7aa)
- TAFITNFTLTIDGVTYPGNVK (21aa)
- TCNASQGFK (9aa)
- NGTYKF (6aa)
- TFYWDFYTNR (10aa)
- ISISNETK (8aa)
- NTTYCSK (7aa)
- TQSLLIVNNATNVVIK (16aa)
- GVNFNVSK (8aa)
- FGCEIENNR (9aa)
- NVTGFTGR (8aa)
- GSNYSEILDK (10aa)
- LNLTTDPK (8aa)
- NGSLFAFR (8aa)
- NLTSEGK (7aa)
- SWPAVGNCSSAIR (13aa)
- SWPAVGNC (8aa)
- DFVNASSK (8aa)
- CNYSIR (6aa)
- ANATIEVK (8aa)
- SATVNLTVIR (10aa)
- NSSLQTNK (8aa)
- NSSTATPVSPGSVTK (15aa)
- IITILEEEMNVSVCGLYTYGKPVPGHVTVSICR (33aa)
- KDNTTVTR (8aa)
- DPCSNVTCSFGSTCAR (16aa)
- HANWTITPIK (10aa)
- IGNWSAMPSCK (11aa)
- MNLTQLK (7aa)
- MIENGSISFIPTIR (14aa)
- YTGNASALF (9aa)
- YIGNATAIFFIPDEGK (16aa)
- GFSTQVLLGDVYQSPCTMAQRPQNFNSSAR (30aa)
- NINYTER (7aa)
- MFSQNDTR (8aa)
- FPNITNLCPFGE (12aa)
- NATDNISK (8aa)
- GVISNVNETSLILEWSEPR (19aa)
- LNTSSLLEQLNEQFNWVSR (19aa)
- LNITCESSK (9aa)
- DLNISEGR (8aa)
- IANITQGEDQYYIR (14aa)
- NTTSVWYTSK (10aa)
- IAGYDLNK (8aa)
- NFTENDLLVR (10aa)
- NYTDCTSEGRR (11aa)
- NYTDCTSEGR (10aa)
- KCGLVPVLAENYNKSDNCEDTPEAGYFAIAVVKK (34aa)
- CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK (33aa)
- SIFLSHNNTK (10aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
- LFQVQGTGANNTK (13aa)
- VNDTFHK (7aa)
- DQCIVDDITYNVNDTFHK (18aa)
- TYENGSSVEYR (11aa)
- NVSYAWK (7aa)
- TCPAGVMGENNTLVWK (16aa)
- NQTSTTLK (8aa)
- MDGSINFNR (9aa)
- NSPNTSPK (8aa)
- TVGNQTSTK (9aa)
- SLGNVNF (7aa)
- VVPEGIRMNK (10aa)
- QVFPGINYCTSGAYSNASSTDSASYYPITGDTR (33aa)
- VVNSTTGPGEHIR (13aa)
- NFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQ (33aa)
- NGTHWFVT (8aa)
- KYFKNHTS (8aa)
- ITTTPTNGQQGNSIEEVVHADQSSCTFDNISPGIEYNVSVYTVK (44aa)
- TWNQSIALR (9aa)
- NASLALSASIGR (12aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 2210.0397)
- Electric Organ (UBERON_0006869)
- Placenta (UBERON_0001987) JEG-3 (CVCL_0363) Epithelium (CL_0002577)
- H9 (CVCL_1240) Lymphocyte (CL_0000542)
- Leukocyte (CL_0000738)
- Abnormal biantennary sugar chains are expressed in human chorionic gonadotropin produced in the choriocarcinoma cell line, JEG-3. (2004 - Takamatsu S, Katsumata T, Inoue N, Watanabe T, Fujibayashi Y, Takeuchi M) / Status : Reviewed
- Structural study of the sugar chains of human leukocyte common antigen CD45. (1993 - Sato T, Furukawa K, Autero M, Gahmberg C, Kobata A) / Status : Reviewed
- Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
- Diversity of oligosaccharide structures on the envelope glycoprotein gp 120 of human immunodeficiency virus 1 from the lymphoblastoid cell line H9. Presence of complex-type oligosaccharides with bisecting N-acetylglucosamine residues. (1990 - Mizuochi T, Matthews T, Kato M, Hamako J, Titani K, Solomon J, Feizi T) / Status : Reviewed
-
Choriogonadotropin - alpha and beta chains / Homo sapiens
- Undefined site
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
-
Acetylcholine receptor protein / Torpedo californica
- Undefined site
-
Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate)
- Undefined site
-
- N-Linked / Complex
(avg mass : 2210.0397)
- 3Y1-B clone 1 (CVCL_4563)
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2210.0397)
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Diversity of oligosaccharide structures on the envelope glycoprotein gp 120 of human immunodeficiency virus 1 from the lymphoblastoid cell line H9. Presence of complex-type oligosaccharides with bisecting N-acetylglucosamine residues. (1990 - Mizuochi T, Matthews T, Kato M, Hamako J, Titani K, Solomon J, Feizi T) / Status : Reviewed
-
Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate)
- Undefined site
-
- N-Linked / Complex
(avg mass : 2210.0397)
- Schizophrenia (DOID:5419)
- Identification of N-glycosylation changes in the CSF and serum in patients with schizophrenia (2010 - Stanta JL, Saldova R, Struwe WB, Byrne JC, Leweke FM, Rothermund M, Rahmoune H, Levin Y, Guest PC, Bahn S, Rudd PM) / Status : Reviewed
- Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
-
Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2210.0397)
- Egg Cell
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2210.0397)
- Egg Cell
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2210.0397)
- Milk (UBERON_0001913)
- Alpha-S1-casein / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Serotransferrin / Homo sapiens
- KDTRNESTQNCVVAEPEKM (19aa)
- KCGLVPVLAENYNKSDNCEDTPEAGYFAIAVVKK (34aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
-
- N-Linked / Complex
(avg mass : 2210.0397)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- FPNITNLCPFGE (12aa)
-
- N-Linked / Complex
(avg mass : 2210.0397)
- Blood Plasma (UBERON_0001969)
- Coagulation factor V / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2210.0397)
-
- N-Linked / Complex
(avg mass : 2210.0397)
- Schizophrenia (DOID:5419)
-
- N-Linked / Complex
(avg mass : 2210.0397)
-
- O-Linked / Core 2
(avg mass : 2210.0397)
- Leukocyte (CL_0000738)
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
-
- Hex:6 HexNAc:6 / N-Linked
(avg mass : 2210.0397)
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-?)[GlcNAc(b1-?)]Man(a1-6)]Man(a1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x Gal(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x Gal(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x Gal(b1-4)"
- N-Linked / Complex / Structure 9463
- N-Linked / Complex / Structure 10011
- N-Linked / Complex / Structure 11157
- N-Linked / Complex / Structure 11547
- N-Linked / Complex / Structure 11602
- N-Linked / Complex / Structure 11862
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Agrin / Homo sapiens
- Alpha-1-antichymotrypsin / Homo sapiens
- Alpha-1-antitrypsin / Homo sapiens
- Alpha-2-macroglobulin / Homo sapiens
- Anoctamin-6 / Homo sapiens
- Apolipoprotein B-100 / Homo sapiens
- Apolipoprotein D / Homo sapiens
- Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
- Beta-2-glycoprotein 1 / Homo sapiens
- Biglycan / Homo sapiens
- Calcium-activated potassium channel subunit alpha-1 / Homo sapiens
- Carnitine O-acetyltransferase / Homo sapiens
- CD97 antigen / Homo sapiens
- Clusterin / Homo sapiens
- Coagulation factor V / Homo sapiens
- Coagulation factor XIII B chain / Homo sapiens
- Complement c1r subcomponent / Homo sapiens
- Complement c3 / Homo sapiens
- Contactin-4 / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
- Ephrin type-B receptor 3 / Homo sapiens
- Ephrin-A3 / Homo sapiens
- Epidermal growth factor receptor / Homo sapiens
- Fibrinogen alpha chain / Homo sapiens
- Fibronectin / Homo sapiens
- Follistatin-related protein 1 / Homo sapiens
- Fractalkine / Homo sapiens
- Golgi apparatus protein 1 / Homo sapiens
- Hemopexin / Homo sapiens
- Heparin cofactor 2 / Homo sapiens
- Immunoglobulin superfamily member 5 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain H3 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain H5 / Homo sapiens
- Interleukin-1 receptor accessory protein / Homo sapiens
- Laminin subunit alpha-5 / Homo sapiens
- Leucine-rich alpha-2-glycoprotein / Homo sapiens
- Leucine-rich repeat-containing protein 4 / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Major facilitator superfamily domain-containing protein 6 / Homo sapiens
- Myelin protein zero-like protein 1 / Homo sapiens
- N-acetylglucosamine-6-sulfatase / Homo sapiens
- Neural cell adhesion molecule L1 / Homo sapiens
- Neuroplastin / Homo sapiens
- Phosphatidylinositol-glycan-specific phospholipase D / Homo sapiens
- Plasma kallikrein / Homo sapiens
- Probable lysosomal cobalamin transporter / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prothrombin / Homo sapiens
- Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
- Secretogranin-3 / Homo sapiens
- Serotransferrin / Homo sapiens
- Serum paraoxonase/arylesterase 1 / Homo sapiens
- Serum paraoxonase/arylesterase 2 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Tissue alpha-L-fucosidase / Homo sapiens
- Transmembrane 9 superfamily member 3 / Homo sapiens
- Transmembrane emp24 domain-containing protein 7 / Homo sapiens
- Villin-1 / Homo sapiens
- Vitronectin / Homo sapiens
- VWFA and cache domain-containing protein 1 / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- CNITCSK (7aa)
- EIFVANGTQGK (11aa)
- FSNVTWF (7aa)
- CIQANYSIMENGK (13aa)
- FHAIHVSGTNGTKRF (15aa)
- NQNGTFK (7aa)
- AFITNF (6aa)
- AIVNFTR (7aa)
- TAFITNFTLTIDGVTYPGNVK (21aa)
- TCNASQGFK (9aa)
- NGTYKF (6aa)
- TFYWDFYTNR (10aa)
- ISISNETK (8aa)
- NTTYCSK (7aa)
- GVNFNVSK (8aa)
- FGCEIENNR (9aa)
- NVTGFTGR (8aa)
- GSNYSEILDK (10aa)
- LNLTTDPK (8aa)
- NGSLFAFR (8aa)
- NLTSEGK (7aa)
- SWPAVGNCSSAIR (13aa)
- SWPAVGNC (8aa)
- DFVNASSK (8aa)
- CNYSIR (6aa)
- ANATIEVK (8aa)
- SATVNLTVIR (10aa)
- NSSLQTNK (8aa)
- NSSTATPVSPGSVTK (15aa)
- IITILEEEMNVSVCGLYTYGKPVPGHVTVSICR (33aa)
- KDNTTVTR (8aa)
- DPCSNVTCSFGSTCAR (16aa)
- HANWTITPIK (10aa)
- IGNWSAMPSCK (11aa)
- MNLTQLK (7aa)
- MIENGSISFIPTIR (14aa)
- YTGNASALF (9aa)
- YIGNATAIFFIPDEGK (16aa)
- GFSTQVLLGDVYQSPCTMAQRPQNFNSSAR (30aa)
- NINYTER (7aa)
- MFSQNDTR (8aa)
- NATDNISK (8aa)
- GVISNVNETSLILEWSEPR (19aa)
- LNTSSLLEQLNEQFNWVSR (19aa)
- LNITCESSK (9aa)
- DLNISEGR (8aa)
- IANITQGEDQYYIR (14aa)
- NTTSVWYTSK (10aa)
- IAGYDLNK (8aa)
- NFTENDLLVR (10aa)
- NYTDCTSEGRR (11aa)
- NYTDCTSEGR (10aa)
- CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK (33aa)
- SIFLSHNNTK (10aa)
- LFQVQGTGANNTK (13aa)
- VNDTFHK (7aa)
- DQCIVDDITYNVNDTFHK (18aa)
- TYENGSSVEYR (11aa)
- NVSYAWK (7aa)
- TCPAGVMGENNTLVWK (16aa)
- NQTSTTLK (8aa)
- MDGSINFNR (9aa)
- NSPNTSPK (8aa)
- TVGNQTSTK (9aa)
- SLGNVNF (7aa)
- VVPEGIRMNK (10aa)
- QVFPGINYCTSGAYSNASSTDSASYYPITGDTR (33aa)
- VVNSTTGPGEHIR (13aa)
- NFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQ (33aa)
- NGTHWFVT (8aa)
- KYFKNHTS (8aa)
- ITTTPTNGQQGNSIEEVVHADQSSCTFDNISPGIEYNVSVYTVK (44aa)
- TWNQSIALR (9aa)
- NASLALSASIGR (12aa)
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:6 HexNAc:6 / N-Linked
(avg mass : 2210.0397)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 2210.0397)
Reported glycosite
- N-Linked / Complex
(avg mass : 2210.0397)
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2210.0397)
Reported glycosite
- N-Linked / Complex
(avg mass : 2210.0397)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2210.0397)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2210.0397)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2210.0397)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2210.0397)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2210.0397)
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2210.0397)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2210.0397)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2210.0397)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2210.0397)