taxonomy (6)
protein (76)
source (11)
structure (9)
composition (1)
disease (4)
reference (13)
site (85)
peptide (79)
- Homo sapiens (Human)
- Rattus norvegicus (Norway rat)
- Gallus gallus (Chicken)
- Torpedo californica (Pacific electric ray)
- Human immunodeficiency virus type 1 (lw12.3 isolate)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Agrin / Homo sapiens O00468
- Alpha-1-antichymotrypsin / Homo sapiens P01011
- Alpha-1-antitrypsin / Homo sapiens P01009
- Alpha-2-macroglobulin / Homo sapiens P01023
- Alpha-n-acetylgalactosaminidase / Homo sapiens P17050
- Alpha-S1-casein / Homo sapiens P47710
- Anoctamin-6 / Homo sapiens Q4KMQ2
- Apolipoprotein B-100 / Homo sapiens P04114
- Apolipoprotein D / Homo sapiens P05090
- Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens P98160
- Beta-2-glycoprotein 1 / Homo sapiens P02749
- Biglycan / Homo sapiens P21810
- Calcium-activated potassium channel subunit alpha-1 / Homo sapiens Q12791
- Carnitine O-acetyltransferase / Homo sapiens P43155
- CD97 antigen / Homo sapiens P48960
- Choriogonadotropin - alpha and beta chains / Homo sapiens P0DN86 P01215
- Clusterin / Homo sapiens P10909
- Coagulation factor V / Homo sapiens P12259
- Coagulation factor XIII B chain / Homo sapiens P05160
- Complement c1r subcomponent / Homo sapiens P00736
- Complement c3 / Homo sapiens P01024
- Contactin-4 / Homo sapiens Q8IWV2
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens P04844
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens Q9Y5L3
- Ephrin type-B receptor 3 / Homo sapiens P54753
- Ephrin-A3 / Homo sapiens P52797
- Epidermal growth factor receptor / Homo sapiens P00533
- Fibrinogen alpha chain / Homo sapiens P02671
- Fibronectin / Homo sapiens P02751
- Follistatin-related protein 1 / Homo sapiens Q12841
- Fractalkine / Homo sapiens P78423
- Golgi apparatus protein 1 / Homo sapiens Q92896
- Hemopexin / Homo sapiens P02790
- Heparin cofactor 2 / Homo sapiens P05546
- Immunoglobulin superfamily member 5 / Homo sapiens Q9NSI5
- Inter-alpha-trypsin inhibitor heavy chain H3 / Homo sapiens Q06033
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens Q14624
- Inter-alpha-trypsin inhibitor heavy chain H5 / Homo sapiens Q86UX2
- Interleukin-1 receptor accessory protein / Homo sapiens Q9NPH3
- Laminin subunit alpha-5 / Homo sapiens O15230
- Leucine-rich alpha-2-glycoprotein / Homo sapiens P02750
- Leucine-rich repeat-containing protein 4 / Homo sapiens Q9HBW1
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Major facilitator superfamily domain-containing protein 6 / Homo sapiens Q6ZSS7
- Myelin protein zero-like protein 1 / Homo sapiens O95297
- N-acetylglucosamine-6-sulfatase / Homo sapiens P15586
- Neural cell adhesion molecule L1 / Homo sapiens P32004
- Neuroplastin / Homo sapiens Q9Y639
- Phosphatidylinositol-glycan-specific phospholipase D / Homo sapiens P80108
- Plasma kallikrein / Homo sapiens P03952
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Probable lysosomal cobalamin transporter / Homo sapiens Q9NUN5
- Prolactin-inducible protein / Homo sapiens P12273
- Prothrombin / Homo sapiens P00734
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens P08575
- Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens Q15262
- Secretogranin-3 / Homo sapiens Q8WXD2
- Serotransferrin / Homo sapiens P02787
- Serum paraoxonase/arylesterase 1 / Homo sapiens P27169
- Serum paraoxonase/arylesterase 2 / Homo sapiens Q15165
- Thrombospondin-1 / Homo sapiens P07996
- Tissue alpha-L-fucosidase / Homo sapiens P04066
- Transmembrane 9 superfamily member 3 / Homo sapiens Q9HD45
- Transmembrane emp24 domain-containing protein 7 / Homo sapiens Q9Y3B3
- Villin-1 / Homo sapiens P09327
- Vitronectin / Homo sapiens P04004
- VWFA and cache domain-containing protein 1 / Homo sapiens Q5VU97
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Uncharacterized protein / Rattus norvegicus
- Uncharacterized protein / Rattus norvegicus
- Uncharacterized protein / Rattus norvegicus
- Riboflavin-binding protein / Gallus gallus P02752
- Acetylcholine receptor protein / Torpedo californica P02712 P02718 P02710 P02714
- Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate) Q70626
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Electric Organ (UBERON_0006869)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO-DG44 (CVCL_7180)
- Placenta (UBERON_0001987) JEG-3 (CVCL_0363) Epithelium (CL_0002577)
- 3Y1-B clone 1 (CVCL_4563)
- FreeStyle 293-F (CVCL_D603)
- H9 (CVCL_1240) Lymphocyte (CL_0000542)
- HEK293 (CVCL_0045)
- Egg Cell
- Leukocyte (CL_0000738)
Source
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-?)[GlcNAc(b1-?)]Man(a1-6)]Man(a1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x Gal(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x Gal(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x Gal(b1-4)"
- N-Linked / Complex / Structure 9463
- N-Linked / Complex / Structure 10011
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
Reported structure
- Hex:6 HexNAc:6 (avg mass : 2210.0397 )
Composition
- Cancer, breast (DOID:1612)
- Choriocarcinoma (DOID:3594)
- COVID-19 (DOID:0080600)
- Leukemia, Acute lymphoblastic (DOID:9952)
Disease
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Abnormal biantennary sugar chains are expressed in human chorionic gonadotropin produced in the choriocarcinoma cell line, JEG-3. (2004 - Takamatsu S, Katsumata T, Inoue N, Watanabe T, Fujibayashi Y, Takeuchi M) / Status : Reviewed
- Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- Structural study of the O-linked sugar chains of human leukocyte tyrosine phosphatase CD45. (1998 - Furukawa K, Funakoshi Y, Autero M, Horejsi V, Kobata A, Gahmberg C) / Status : Reviewed
- Structural study of the sugar chains of human leukocyte common antigen CD45. (1993 - Sato T, Furukawa K, Autero M, Gahmberg C, Kobata A) / Status : Reviewed
- Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
- Diversity of oligosaccharide structures on the envelope glycoprotein gp 120 of human immunodeficiency virus 1 from the lymphoblastoid cell line H9. Presence of complex-type oligosaccharides with bisecting N-acetylglucosamine residues. (1990 - Mizuochi T, Matthews T, Kato M, Hamako J, Titani K, Solomon J, Feizi T) / Status : Reviewed
- Transfection with fragments of the adenovirus 12 gene induces tumorigenicity-associated alteration of N-linked sugar chains in rat cells. (1990 - Hiraizumi S, Takasaki S, Shiroki K, Kochibe N, Kobata A) / Status : Reviewed
Reference
- Agrin / Homo sapiens
- Alpha-1-antichymotrypsin / Homo sapiens
- Alpha-1-antitrypsin / Homo sapiens
- Alpha-2-macroglobulin / Homo sapiens
-
Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
- Alpha-S1-casein / Homo sapiens
- Anoctamin-6 / Homo sapiens
- Apolipoprotein B-100 / Homo sapiens
- Apolipoprotein D / Homo sapiens
- Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
- Beta-2-glycoprotein 1 / Homo sapiens
- Biglycan / Homo sapiens
- Calcium-activated potassium channel subunit alpha-1 / Homo sapiens
- Carnitine O-acetyltransferase / Homo sapiens
- CD97 antigen / Homo sapiens
-
Choriogonadotropin - alpha and beta chains / Homo sapiens
- Undefined site
- Clusterin / Homo sapiens
- Coagulation factor V / Homo sapiens
- Coagulation factor XIII B chain / Homo sapiens
- Complement c1r subcomponent / Homo sapiens
- Complement c3 / Homo sapiens
- Contactin-4 / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
- Ephrin type-B receptor 3 / Homo sapiens
- Ephrin-A3 / Homo sapiens
- Epidermal growth factor receptor / Homo sapiens
- Fibrinogen alpha chain / Homo sapiens
- Fibronectin / Homo sapiens
- Follistatin-related protein 1 / Homo sapiens
- Fractalkine / Homo sapiens
- Golgi apparatus protein 1 / Homo sapiens
- Hemopexin / Homo sapiens
- Heparin cofactor 2 / Homo sapiens
- Immunoglobulin superfamily member 5 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain H3 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain H5 / Homo sapiens
- Interleukin-1 receptor accessory protein / Homo sapiens
- Laminin subunit alpha-5 / Homo sapiens
- Leucine-rich alpha-2-glycoprotein / Homo sapiens
- Leucine-rich repeat-containing protein 4 / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Major facilitator superfamily domain-containing protein 6 / Homo sapiens
- Myelin protein zero-like protein 1 / Homo sapiens
- N-acetylglucosamine-6-sulfatase / Homo sapiens
- Neural cell adhesion molecule L1 / Homo sapiens
- Neuroplastin / Homo sapiens
- Phosphatidylinositol-glycan-specific phospholipase D / Homo sapiens
- Plasma kallikrein / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Probable lysosomal cobalamin transporter / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prothrombin / Homo sapiens
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
- Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
- Secretogranin-3 / Homo sapiens
- Serotransferrin / Homo sapiens
- Serum paraoxonase/arylesterase 1 / Homo sapiens
- Serum paraoxonase/arylesterase 2 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Tissue alpha-L-fucosidase / Homo sapiens
- Transmembrane 9 superfamily member 3 / Homo sapiens
- Transmembrane emp24 domain-containing protein 7 / Homo sapiens
- Villin-1 / Homo sapiens
- Vitronectin / Homo sapiens
- VWFA and cache domain-containing protein 1 / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Acetylcholine receptor protein / Torpedo californica
- Undefined site
-
Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate)
- Undefined site
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- CNITCSK (7aa)
- EIFVANGTQGK (11aa)
- FSNVTWF (7aa)
- CIQANYSIMENGK (13aa)
- KDTRNESTQNCVVAEPEKM (19aa)
- FHAIHVSGTNGTKRF (15aa)
- NQNGTFK (7aa)
- AFITNF (6aa)
- AIVNFTR (7aa)
- TAFITNFTLTIDGVTYPGNVK (21aa)
- TCNASQGFK (9aa)
- NGTYKF (6aa)
- TFYWDFYTNR (10aa)
- ISISNETK (8aa)
- NTTYCSK (7aa)
- TQSLLIVNNATNVVIK (16aa)
- GVNFNVSK (8aa)
- FGCEIENNR (9aa)
- NVTGFTGR (8aa)
- GSNYSEILDK (10aa)
- LNLTTDPK (8aa)
- NGSLFAFR (8aa)
- NLTSEGK (7aa)
- SWPAVGNCSSAIR (13aa)
- SWPAVGNC (8aa)
- DFVNASSK (8aa)
- CNYSIR (6aa)
- ANATIEVK (8aa)
- SATVNLTVIR (10aa)
- NSSLQTNK (8aa)
- NSSTATPVSPGSVTK (15aa)
- IITILEEEMNVSVCGLYTYGKPVPGHVTVSICR (33aa)
- KDNTTVTR (8aa)
- DPCSNVTCSFGSTCAR (16aa)
- HANWTITPIK (10aa)
- IGNWSAMPSCK (11aa)
- MNLTQLK (7aa)
- MIENGSISFIPTIR (14aa)
- YTGNASALF (9aa)
- YIGNATAIFFIPDEGK (16aa)
- GFSTQVLLGDVYQSPCTMAQRPQNFNSSAR (30aa)
- NINYTER (7aa)
- MFSQNDTR (8aa)
- FPNITNLCPFGE (12aa)
- NATDNISK (8aa)
- GVISNVNETSLILEWSEPR (19aa)
- LNTSSLLEQLNEQFNWVSR (19aa)
- LNITCESSK (9aa)
- DLNISEGR (8aa)
- IANITQGEDQYYIR (14aa)
- NTTSVWYTSK (10aa)
- IAGYDLNK (8aa)
- NFTENDLLVR (10aa)
- NYTDCTSEGRR (11aa)
- NYTDCTSEGR (10aa)
- KCGLVPVLAENYNKSDNCEDTPEAGYFAIAVVKK (34aa)
- CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK (33aa)
- SIFLSHNNTK (10aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
- LFQVQGTGANNTK (13aa)
- VNDTFHK (7aa)
- DQCIVDDITYNVNDTFHK (18aa)
- TYENGSSVEYR (11aa)
- NVSYAWK (7aa)
- TCPAGVMGENNTLVWK (16aa)
- NQTSTTLK (8aa)
- MDGSINFNR (9aa)
- NSPNTSPK (8aa)
- TVGNQTSTK (9aa)
- SLGNVNF (7aa)
- VVPEGIRMNK (10aa)
- QVFPGINYCTSGAYSNASSTDSASYYPITGDTR (33aa)
- VVNSTTGPGEHIR (13aa)
- NFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQ (33aa)
- NGTHWFVT (8aa)
- KYFKNHTS (8aa)
- ITTTPTNGQQGNSIEEVVHADQSSCTFDNISPGIEYNVSVYTVK (44aa)
- TWNQSIALR (9aa)
- NASLALSASIGR (12aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 2210.0397)
- Electric Organ (UBERON_0006869)
- Placenta (UBERON_0001987) JEG-3 (CVCL_0363) Epithelium (CL_0002577)
- H9 (CVCL_1240) Lymphocyte (CL_0000542)
- Leukocyte (CL_0000738)
- Abnormal biantennary sugar chains are expressed in human chorionic gonadotropin produced in the choriocarcinoma cell line, JEG-3. (2004 - Takamatsu S, Katsumata T, Inoue N, Watanabe T, Fujibayashi Y, Takeuchi M) / Status : Reviewed
- Structural study of the sugar chains of human leukocyte common antigen CD45. (1993 - Sato T, Furukawa K, Autero M, Gahmberg C, Kobata A) / Status : Reviewed
- Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
- Diversity of oligosaccharide structures on the envelope glycoprotein gp 120 of human immunodeficiency virus 1 from the lymphoblastoid cell line H9. Presence of complex-type oligosaccharides with bisecting N-acetylglucosamine residues. (1990 - Mizuochi T, Matthews T, Kato M, Hamako J, Titani K, Solomon J, Feizi T) / Status : Reviewed
-
Choriogonadotropin - alpha and beta chains / Homo sapiens
- Undefined site
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
-
Acetylcholine receptor protein / Torpedo californica
- Undefined site
-
Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate)
- Undefined site
-
- N-Linked / Complex
(avg mass : 2210.0397)
- 3Y1-B clone 1 (CVCL_4563)
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2210.0397)
- H9 (CVCL_1240) Lymphocyte (CL_0000542)
-
Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate)
- Undefined site
-
- N-Linked / Complex
(avg mass : 2210.0397)
- Ovary (UBERON_0000992) CHO-DG44 (CVCL_7180)
-
Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2210.0397)
- Egg Cell
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2210.0397)
- Egg Cell
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2210.0397)
- Milk (UBERON_0001913)
- Alpha-S1-casein / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Serotransferrin / Homo sapiens
- KDTRNESTQNCVVAEPEKM (19aa)
- KCGLVPVLAENYNKSDNCEDTPEAGYFAIAVVKK (34aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
-
- N-Linked / Complex
(avg mass : 2210.0397)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- FPNITNLCPFGE (12aa)
-
- O-Linked / Core 2
(avg mass : 2210.0397)
- Leukocyte (CL_0000738)
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
-
- Hex:6 HexNAc:6 / N-Linked
(avg mass : 2210.0397)
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-?)[GlcNAc(b1-?)]Man(a1-6)]Man(a1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x Gal(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x Gal(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x Gal(b1-4)"
- N-Linked / Complex / Structure 9463
- N-Linked / Complex / Structure 10011
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Agrin / Homo sapiens
- Alpha-1-antichymotrypsin / Homo sapiens
- Alpha-1-antitrypsin / Homo sapiens
- Alpha-2-macroglobulin / Homo sapiens
- Anoctamin-6 / Homo sapiens
- Apolipoprotein B-100 / Homo sapiens
- Apolipoprotein D / Homo sapiens
- Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
- Beta-2-glycoprotein 1 / Homo sapiens
- Biglycan / Homo sapiens
- Calcium-activated potassium channel subunit alpha-1 / Homo sapiens
- Carnitine O-acetyltransferase / Homo sapiens
- CD97 antigen / Homo sapiens
- Clusterin / Homo sapiens
- Coagulation factor V / Homo sapiens
- Coagulation factor XIII B chain / Homo sapiens
- Complement c1r subcomponent / Homo sapiens
- Complement c3 / Homo sapiens
- Contactin-4 / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
- Ephrin type-B receptor 3 / Homo sapiens
- Ephrin-A3 / Homo sapiens
- Epidermal growth factor receptor / Homo sapiens
- Fibrinogen alpha chain / Homo sapiens
- Fibronectin / Homo sapiens
- Follistatin-related protein 1 / Homo sapiens
- Fractalkine / Homo sapiens
- Golgi apparatus protein 1 / Homo sapiens
- Hemopexin / Homo sapiens
- Heparin cofactor 2 / Homo sapiens
- Immunoglobulin superfamily member 5 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain H3 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain H5 / Homo sapiens
- Interleukin-1 receptor accessory protein / Homo sapiens
- Laminin subunit alpha-5 / Homo sapiens
- Leucine-rich alpha-2-glycoprotein / Homo sapiens
- Leucine-rich repeat-containing protein 4 / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Major facilitator superfamily domain-containing protein 6 / Homo sapiens
- Myelin protein zero-like protein 1 / Homo sapiens
- N-acetylglucosamine-6-sulfatase / Homo sapiens
- Neural cell adhesion molecule L1 / Homo sapiens
- Neuroplastin / Homo sapiens
- Phosphatidylinositol-glycan-specific phospholipase D / Homo sapiens
- Plasma kallikrein / Homo sapiens
- Probable lysosomal cobalamin transporter / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prothrombin / Homo sapiens
- Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
- Secretogranin-3 / Homo sapiens
- Serotransferrin / Homo sapiens
- Serum paraoxonase/arylesterase 1 / Homo sapiens
- Serum paraoxonase/arylesterase 2 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Tissue alpha-L-fucosidase / Homo sapiens
- Transmembrane 9 superfamily member 3 / Homo sapiens
- Transmembrane emp24 domain-containing protein 7 / Homo sapiens
- Villin-1 / Homo sapiens
- Vitronectin / Homo sapiens
- VWFA and cache domain-containing protein 1 / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- CNITCSK (7aa)
- EIFVANGTQGK (11aa)
- FSNVTWF (7aa)
- CIQANYSIMENGK (13aa)
- FHAIHVSGTNGTKRF (15aa)
- NQNGTFK (7aa)
- AFITNF (6aa)
- AIVNFTR (7aa)
- TAFITNFTLTIDGVTYPGNVK (21aa)
- TCNASQGFK (9aa)
- NGTYKF (6aa)
- TFYWDFYTNR (10aa)
- ISISNETK (8aa)
- NTTYCSK (7aa)
- GVNFNVSK (8aa)
- FGCEIENNR (9aa)
- NVTGFTGR (8aa)
- GSNYSEILDK (10aa)
- LNLTTDPK (8aa)
- NGSLFAFR (8aa)
- NLTSEGK (7aa)
- SWPAVGNCSSAIR (13aa)
- SWPAVGNC (8aa)
- DFVNASSK (8aa)
- CNYSIR (6aa)
- ANATIEVK (8aa)
- SATVNLTVIR (10aa)
- NSSLQTNK (8aa)
- NSSTATPVSPGSVTK (15aa)
- IITILEEEMNVSVCGLYTYGKPVPGHVTVSICR (33aa)
- KDNTTVTR (8aa)
- DPCSNVTCSFGSTCAR (16aa)
- HANWTITPIK (10aa)
- IGNWSAMPSCK (11aa)
- MNLTQLK (7aa)
- MIENGSISFIPTIR (14aa)
- YTGNASALF (9aa)
- YIGNATAIFFIPDEGK (16aa)
- GFSTQVLLGDVYQSPCTMAQRPQNFNSSAR (30aa)
- NINYTER (7aa)
- MFSQNDTR (8aa)
- NATDNISK (8aa)
- GVISNVNETSLILEWSEPR (19aa)
- LNTSSLLEQLNEQFNWVSR (19aa)
- LNITCESSK (9aa)
- DLNISEGR (8aa)
- IANITQGEDQYYIR (14aa)
- NTTSVWYTSK (10aa)
- IAGYDLNK (8aa)
- NFTENDLLVR (10aa)
- NYTDCTSEGRR (11aa)
- NYTDCTSEGR (10aa)
- CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK (33aa)
- SIFLSHNNTK (10aa)
- LFQVQGTGANNTK (13aa)
- VNDTFHK (7aa)
- DQCIVDDITYNVNDTFHK (18aa)
- TYENGSSVEYR (11aa)
- NVSYAWK (7aa)
- TCPAGVMGENNTLVWK (16aa)
- NQTSTTLK (8aa)
- MDGSINFNR (9aa)
- NSPNTSPK (8aa)
- TVGNQTSTK (9aa)
- SLGNVNF (7aa)
- VVPEGIRMNK (10aa)
- QVFPGINYCTSGAYSNASSTDSASYYPITGDTR (33aa)
- VVNSTTGPGEHIR (13aa)
- NFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQ (33aa)
- NGTHWFVT (8aa)
- KYFKNHTS (8aa)
- ITTTPTNGQQGNSIEEVVHADQSSCTFDNISPGIEYNVSVYTVK (44aa)
- TWNQSIALR (9aa)
- NASLALSASIGR (12aa)
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:6 HexNAc:6 / N-Linked
(avg mass : 2210.0397)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 2210.0397)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2210.0397)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2210.0397)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2210.0397)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2210.0397)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2210.0397)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2210.0397)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2210.0397)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2210.0397)